(data stored in ACNUC7421 zone)

EMBL: CP000271.PE363

CP000271.PE363       Location/Qualifiers
FT   CDS_pept        complement(417637..418296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2662"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33331"
FT                   /db_xref="GOA:Q13RF8"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF8"
FT                   /protein_id="ABE33331.1"
FT                   /translation="MPMSQEIDYLNPALPAGLRRVSMSVVDATPATLDGFGCLVTDPSK
FT                   CSIEIVQWPAAGTRPIDPGTGDEAGTTEGTFVSEWRGDILYGRNEAVGGNYILAYAREP
FT                   EAARDDHANAPERMLLWHANYHPDGGQLFFPLDHRPFYVPLALPGDDITPEKFVCFRFD
FT                   GQQGLYIHPNIWHEGVFTLEGTQRFFDKQGAVHARVSVDFAREFGCLLEAPIAGDA"
     atgccgatgt cccaagaaat cgattacctc aaccccgccc ttcccgctgg ccttcgacgc        60
     gtttcgatgt ccgtggtcga cgcgacccct gcaacgctcg acggctttgg ctgccttgtg       120
     acagacccga gcaaatgttc gatcgagatc gtgcagtggc cggcggcggg aacacgaccc       180
     atagaccctg gaaccggtga cgaggcaggc acgaccgaag ggacattcgt gagcgagtgg       240
     cgcggagata ttctctacgg ccgaaacgaa gccgtgggtg gcaactatat ccttgcgtac       300
     gcaagggagc ccgaagcggc ccgcgacgac cacgccaatg cacccgaacg catgctgctc       360
     tggcacgcga actaccaccc ggacggcgga caactgttct ttcctctcga ccatcgtccg       420
     ttctacgttc cactcgcatt gccgggcgac gacattacgc cggagaagtt cgtatgcttt       480
     cgcttcgatg gccagcaggg tctctatatc cacccaaaca tctggcacga aggcgtgttc       540
     actcttgaag ggacgcagcg gttcttcgac aagcagggcg cagtccatgc gcgcgtttct       600
     gtcgactttg cccgcgagtt tggctgtctt ctcgaagcgc cgatcgccgg ggacgcctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page