(data stored in ACNUC7421 zone)

EMBL: CP000271.PE365

CP000271.PE365       Location/Qualifiers
FT   CDS_pept        complement(420542..420985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2660"
FT                   /product="Conserved hypothetical protein"
FT                   /note="DNA-binding domain present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2660"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33333"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF6"
FT                   /protein_id="ABE33333.1"
FT                   /translation="MQAHPLRLFPGDDLRVALENVLHQSGLQAAFVIQGIGSLSVAQLR
FT                   FAGKEDPTELRDDLEILTLAGSISPDGAHLHMSVADPRGQVSGGHVARGCVIRTTAEIL
FT                   LVLLPDYRFSRERDPGSGFMELVIRNEPATDHARQLRADNLDE"
     atgcaagcac atcccttacg cctctttccc ggcgacgatc tgcgtgtcgc cctcgaaaac        60
     gtgctgcatc agtccggatt gcaggcggcc ttcgtgatcc agggcatagg tagcctcagc       120
     gttgcgcaat tgcgattcgc cgggaaagag gatccgactg aactgcgcga cgatctggaa       180
     atcctcacgc tcgccggttc catatcacct gatggagcgc atctgcacat gtcggtcgcc       240
     gacccgcgcg gccaggtgtc tggtggccac gtggcacgcg gttgcgtgat ccgcacgacc       300
     gcggagatat tgctggtgct tcttcccgac tatcgcttct cccgtgaacg cgacccgggt       360
     tcaggattca tggaactggt gatacggaat gaaccagcca cggatcatgc tcgccagttg       420
     cgtgcggaca atctcgacga atag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page