(data stored in ACNUC7421 zone)

EMBL: CP000271.PE367

CP000271.PE367       Location/Qualifiers
FT   CDS_pept        422160..423008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2658"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2658"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33335"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF4"
FT                   /protein_id="ABE33335.1"
FT                   /translation="MSKRRLSSLVLAALFPFGALIHPLAANADTLDDIKSRGTMTVAID
FT                   PTFAPYEYTDANNNIVGFDPAVMDAVARHLGVKIEYQRMSFSGIIPGLLAHSFDVEGSA
FT                   LNVTSERAKRLAYVVPTSKTVNGALVRSDFRKIPQPATIESLAGLTAAVKSASAPEQIL
FT                   KQFNETLKAKGLAPIQLISVDSVDQTVAALMTRRADFVFDDMTVLAGVIKQNPGKLKST
FT                   GELGPSQWIAWATRPDDTRLNKAISDQILAMKKSGELARLQKANLGVTFDTPTSDFIPA
FT                   Q"
     atgtcaaaac gccgcctctc cagccttgtc ctcgccgcgt tgtttccgtt cggcgcattg        60
     atccacccgc tagccgcgaa cgccgatacg ctcgacgaca tcaaaagccg cggcacgatg       120
     accgtcgcga tcgatccgac ctttgcgccg tacgaataca ccgacgccaa caacaacatc       180
     gtcggcttcg acccggccgt gatggacgcg gttgcgaggc atctgggcgt aaagatcgaa       240
     tatcagcgta tgtcattcag cgggatcatc ccgggcctgc tcgcgcattc attcgatgtc       300
     gaaggttccg cgctgaacgt aacgtccgaa cgcgcaaagc gtctcgcgta cgtagtgccg       360
     accagcaaga ccgtaaacgg cgctctggta cgttcggatt tcaggaagat tccgcagccg       420
     gccaccatcg agtctcttgc cggcctgacg gccgcggtca agagcgcgag cgcgcccgaa       480
     cagatcctca agcagttcaa cgagacgctg aaggccaaag gtctcgcacc gatccagttg       540
     atcagcgtgg atagcgtgga ccagacagtg gctgcgttga tgacacgtcg cgccgatttc       600
     gtgttcgacg atatgaccgt gcttgccggc gtcatcaaac agaatccggg caagctgaaa       660
     tcgaccggtg agctcggacc ctcgcaatgg attgcgtggg cgacccggcc ggacgacacg       720
     cgtctgaaca aggcgatcag cgaccagatc ctcgcaatga aaaagtcagg cgaactcgct       780
     cgcctgcaaa aggccaacct gggtgtgacc ttcgacacgc cgacgtccga tttcatcccc       840
     gcgcagtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page