(data stored in ACNUC7421 zone)

EMBL: CP000271.PE368

CP000271.PE368       Location/Qualifiers
FT   CDS_pept        423027..423641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2657"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2657"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33336"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF3"
FT                   /protein_id="ABE33336.1"
FT                   /translation="MTDSAQMLTIKAGHGRTFEVKAGQRLTITDVEGQQAADFVAVVKS
FT                   NHDEKLSPTHTRRQLRTLFFNVGDALYSSLGRPLLRVLEDTVGIHDANVPACDDTRFTV
FT                   DFNVTGHRNCLDNMHAGLALYGLSPFDVPEPFNLFQNGPVTQDCRMQVTDPTSKPGDYI
FT                   TFDVLEDLVCAVSSCPQDIIPGNGLKVTDIAVSILPAASAA"
     atgaccgatt ccgcacaaat gcttaccatc aaggcaggac acgggcgcac cttcgaagtg        60
     aaggcgggcc aacggttgac cattacagac gtcgaaggcc agcaggcggc cgacttcgtc       120
     gcggtggtca agtcgaatca tgacgagaag ctgtcgccga cgcatacgcg ccgccagctc       180
     cggacgctgt ttttcaacgt cggcgacgcg ttgtattcgt cactggggcg cccgttgttg       240
     cgagtgctcg aagacaccgt cggcattcac gacgccaacg tgcccgcctg cgacgacacg       300
     cggttcacgg tcgatttcaa cgtgaccggg catcgcaact gcctcgacaa catgcacgcg       360
     ggtctcgcgc tgtacgggct gtcgcccttc gatgtgccgg agcccttcaa cctgttccag       420
     aacggcccgg tcacgcagga ttgccggatg caggtcacgg atccgaccag caagcccggt       480
     gactacatca cgttcgacgt actcgaagat ctggtatgcg ccgtgtcgtc gtgtccgcag       540
     gacatcattc ccggcaacgg cctgaaggtg accgacattg ccgtttccat cctgcccgcg       600
     gcatccgccg cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page