(data stored in ACNUC7421 zone)

EMBL: CP000271.PE369

CP000271.PE369       Location/Qualifiers
FT   CDS_pept        423653..424288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2656"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2656"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33337"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF2"
FT                   /protein_id="ABE33337.1"
FT                   /translation="MLLLKEPPSRAPLCPQTVAVPAGESRAIDVKAGQILRIEAKEPGA
FT                   VASMFGFSRINDDVYMSVHHTRVFSNSYVLQAGMRIVSNRRRALMVLGKDSSGKHDLLL
FT                   PASTTAYLAEQGYAGLTGCIESVGAVIQSLGLKPPKMPDPINLFMHVTLHQDGRIEPLP
FT                   NTTRAGDFVACRVVTDMVFIVSACCTGIPGNDVPGALELSAAEELDQL"
     atgctgcttc tcaaagaacc gccttcgcgc gcaccgctgt gcccgcaaac cgtcgccgtg        60
     cctgcgggag aatcgcgcgc gatcgacgtc aaggcaggcc agatcctgcg tatcgaagca       120
     aaagagccgg gcgcggtcgc gtcgatgttc ggcttcagca ggatcaacga cgacgtgtac       180
     atgtcggttc atcacacgcg cgtgttcagc aattcgtatg tgttgcaggc gggcatgcgg       240
     atcgtaagca accgccgccg cgcgttgatg gtgctcggca aggactcgag cggcaaacac       300
     gatctgctat tgcccgcatc gaccactgcg tatcttgcgg agcagggcta cgcggggctg       360
     accggctgca ttgaatcggt cggcgcggtg attcagtcgc tgggcctgaa gccgcccaaa       420
     atgcccgacc cgatcaatct gttcatgcac gtgacgttgc atcaggacgg ccgtatcgaa       480
     ccgttgccca acaccacgcg tgcgggcgat ttcgttgcgt gccgggtggt gacggacatg       540
     gtgttcatcg tgtcggcctg ctgcaccggc attcccggca acgacgtgcc cggcgcgctc       600
     gaactgtcgg cggccgaaga actcgaccaa ctctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page