(data stored in SCRATCH zone)

EMBL: CP000271.PE37

CP000271.PE37        Location/Qualifiers
FT   CDS_pept        39594..39851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2991"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD4"
FT                   /protein_id="ABE33005.1"
FT                   /translation="MTQDVTPKPPTGDRPELEHLDAALSHVDQQVSSGSIASGAAKGIL
FT                   YSLIETLGTFVGDPDLPEHARSGYEGLLEAARELRAKLDH"
     atgacgcaag acgtaacgcc caaaccgccc actggcgacc ggcccgagtt ggagcacctc        60
     gacgcggcgc tcagccacgt ggatcagcag gtatcttcag gcagcattgc atccggcgcc       120
     gcgaagggca ttctgtatag cctgatcgaa acgctcggca cgtttgttgg cgaccccgat       180
     ctgccggagc acgcgcgttc gggttacgag ggattgctgg aagccgctcg cgaattacgc       240
     gcgaagctgg atcactaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page