(data stored in ACNUC7421 zone)

EMBL: CP000271.PE370

CP000271.PE370       Location/Qualifiers
FT   CDS_pept        424306..424989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2655"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33338"
FT                   /db_xref="GOA:Q13RF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF1"
FT                   /protein_id="ABE33338.1"
FT                   /translation="MGFDPQVIHSLPTLIDGWLLTVELTLLGATGSLVFGHLALAMQLT
FT                   RIAPLRWAARLYISFMRGTPALVQLFVLFFALPLIGLGGRPMLAAALTLGLNSGAYTAE
FT                   ILRGNLRVITPGQYEAAIALGMAPSRIALRIAMPQMLKASLPALINEFTILLKTTPLAS
FT                   VVAVTELTYAGQMVIARTYTSAQVMLLVSVGYLAVALPVIYAARRAQRSPRMPGAGRVA
FT                   PGVAR"
     atgggctttg acccgcaagt gattcacagc ctgccgacac tcatcgacgg ctggctgctg        60
     accgtggaac tgacgctgct cggcgcaacc ggcagtctcg tgttcggcca tctcgcgctc       120
     gcgatgcaac tgacacgtat cgcaccgttg cgctgggccg cgcggctcta tatcagcttc       180
     atgcgcggca cgcccgccct cgtgcaactg ttcgtgctct tcttcgcgct gccgctgatc       240
     gggctgggcg gtcgtccgat gctggccgcc gcgctcacgc tcggtctgaa tagcggcgcc       300
     tacacggcgg aaatcctgcg aggtaatctg cgggtgatca caccggggca gtacgaagcc       360
     gcgattgcac tcggcatggc gccgagtcgc atcgcgttga ggatcgccat gccgcaaatg       420
     ctgaaggcga gcctgcccgc actcatcaat gaattcacga tcctgttgaa gaccacgccg       480
     ctcgcgtcgg tggtcgcggt caccgaattg acgtacgcgg gccagatggt gatcgcacga       540
     acctacacgt cggcgcaagt gatgctgctg gtcagcgtcg gctatctggc ggtcgcgttg       600
     ccggtcatct atgccgcgcg ccgcgcgcag cgttcgccgc gcatgcccgg cgccgggcgg       660
     gtcgcgccgg gagtggcgcg atga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page