(data stored in ACNUC7421 zone)

EMBL: CP000271.PE371

CP000271.PE371       Location/Qualifiers
FT   CDS_pept        424986..425660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2654"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2654"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33339"
FT                   /db_xref="GOA:Q13RF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RF0"
FT                   /protein_id="ABE33339.1"
FT                   /translation="MTFDLSVLSGYWPQLAAGFGSTVWLCAAGAAMSGVLGVLLTVGQR
FT                   RGGPWLAAVIRGYTALTLGLPLLVLLYVMFFVLPDFGVLLPAPLVGTVTLAIYYGPYVA
FT                   EVIGAAVAAVPAGTVEAGVAIGMSPVAIARRIVAPQALPLLLPTLTGLLIGLVKDSALL
FT                   SVISVHEFMFAAKAVVSDTYAPLEVYFVVALVYWAATSVVHFSTRHWERRLGRVHRVSL
FT                   PR"
     atgaccttcg atctgagcgt tctgtccggc tactggccgc agcttgcagc aggattcggc        60
     agcacggtct ggttgtgtgc ggccggtgcc gcgatgtcgg gtgtgctcgg cgttctgctg       120
     acggtcggtc agcggcgcgg tggtccgtgg ctggctgcgg tgattcgcgg ctacaccgca       180
     ctgacgctcg gcttgccgct gctcgtactg ctgtacgtga tgtttttcgt gttgccggat       240
     ttcggcgtgc tgctgcccgc accgctggtc ggcacggtca cgctggcgat ctattacggc       300
     ccgtacgtcg cggaagtgat tggggcggct gttgccgccg tgcccgcggg caccgtcgaa       360
     gcaggcgtcg cgatcggcat gtcgccggtt gcgatcgcgc gccgcatcgt cgcgccgcaa       420
     gcgctgccgc tgctgctacc cacgctgacg ggcctgctga taggcctcgt caaggattcc       480
     gcgttgctgt cggtgatctc cgtgcacgaa ttcatgttcg ccgcgaaggc cgttgtgtcg       540
     gatacctacg caccgctcga agtctatttc gtcgtcgcgt tggtctattg ggccgcgacg       600
     tccgtcgtcc atttttcgac ccgtcattgg gagcgccgtc tcggccgcgt ccatcgggtc       660
     tctctgccgc ggtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page