(data stored in ACNUC7421 zone)

EMBL: CP000271.PE372

CP000271.PE372       Location/Qualifiers
FT   CDS_pept        425666..426469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2653"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2653"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33340"
FT                   /db_xref="GOA:Q13RE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE9"
FT                   /protein_id="ABE33340.1"
FT                   /translation="MEPSDSTPLVALKASGIVKSFGANRILDGVDLTVARGETVCVLGP
FT                   SGSGKSTLLRCLNWLSPPDEGAVWIGDQRLGLRETPNGATSPRPEREIRAQRSRIGMVF
FT                   QSFNLWPHMTALENVMEGLLSVKRMNRLDATDLAVEALRQVGLGGKHTSMPANLSGGQQ
FT                   QRVGIARTLAMAPEVILFDEPTSALDPELVGEVLAVMRGLAANATTMIVVTHEIGFARD
FT                   VSDRVIFMDRGRIVEQGPPAQVLDAPSSPRLQQFLYRFTPENSRS"
     atggaaccat ccgacagcac gccactcgtg gcattgaagg cgagcggtat cgtcaagtcg        60
     ttcggcgcga accgcattct cgacggcgtc gatctgaccg tcgcgcgcgg cgaaacggtt       120
     tgcgtactcg gtccgtcggg ctccggaaaa tcgacgctgt tgcgctgcct gaactggctt       180
     tctccacccg acgaaggcgc cgtctggatc ggcgaccagc ggctcggttt gcgcgagacc       240
     ccgaacggcg cgacgagccc gcgacccgag cgcgaaatac gcgcgcagcg cagccggatc       300
     ggcatggtat ttcagagttt caatctgtgg ccgcatatga cggcgctcga aaacgtgatg       360
     gaaggtctgc tgtcggtgaa acggatgaac cgtctcgacg ccactgatct cgccgtggaa       420
     gcgctgcgcc aggtcggcct gggcggcaag cacacgtcga tgcccgcgaa cctgtccggc       480
     gggcagcagc agcgtgtcgg cattgcccgc acgcttgcaa tggcgccgga agtcatcctg       540
     ttcgatgagc cgaccagcgc gctcgacccg gaactggtcg gcgaagtgct ggccgtcatg       600
     cgcgggctcg ccgcgaacgc tacgacgatg atcgtcgtca cgcacgaaat cggctttgcg       660
     cgcgatgtct cggaccgcgt gattttcatg gaccgtggac gcatcgtcga acagggtccg       720
     ccggcgcagg tgctcgacgc accgtcgtcg ccgcgactcc agcaatttct ctatcgcttt       780
     acaccggaaa actcacgctc atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page