(data stored in ACNUC7421 zone)

EMBL: CP000271.PE373

CP000271.PE373       Location/Qualifiers
FT   CDS_pept        426466..427134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2652"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2652"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33341"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE8"
FT                   /protein_id="ABE33341.1"
FT                   /translation="MSYTNHPTATVPAGHGKAVRLKAGQAVRVINTHGTQVVDCWAWNA
FT                   YDLNEYMCMETTRVWNQRLNPVVGDSFVTNLRHPVLTVVEDTTPGVHDTFMAACDRKRY
FT                   ELLGVRGYHRNCCDNMFEGMFELGVTPPRQNLASFNIFMNIRVQPDGITLHTLPTVTKP
FT                   GEYITLRAEMDCFVAFSACPQDIVKIQGQGDNTPKPVDIAVLDDFLSDLPGTQPWVPEA
FT                   "
     atgagctata caaatcatcc caccgcaacc gttcccgccg gccacggcaa ggcagtacgg        60
     ctgaaagcgg gccaggccgt acgcgtcatc aatacccacg gcacgcaagt cgtggactgc       120
     tgggcctgga atgcgtatga cctgaacgaa tatatgtgca tggaaaccac gcgtgtgtgg       180
     aaccagagac tcaacccagt ggtgggagac agcttcgtga ccaacctgcg ccatccggtg       240
     ctgaccgtcg tggaagacac gacgcccggc gtccacgaca ccttcatggc ggcctgcgat       300
     cgcaagcgtt atgaactgct cggcgtgcgc ggctatcacc gcaactgttg cgacaacatg       360
     ttcgaaggca tgtttgaact cggcgttacg ccgccgcgcc agaacctcgc ttcgttcaac       420
     atcttcatga atatccgcgt gcagccggac ggcatcacgc tgcatacgtt gcctacggtg       480
     acaaagcctg gcgagtacat cacgctgcgc gccgaaatgg actgcttcgt tgcgttttcc       540
     gcgtgtccgc aggacatcgt caagatccag ggccaaggcg acaacacgcc gaaaccggtt       600
     gatatcgccg tgctcgacga cttcctgtcc gatctcccgg gcacgcaacc gtgggttccg       660
     gaagcttga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page