(data stored in ACNUC7421 zone)

EMBL: CP000271.PE376

CP000271.PE376       Location/Qualifiers
FT   CDS_pept        428973..430103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2649"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33344"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE5"
FT                   /protein_id="ABE33344.1"
FT                   /translation="MTSLPAFVSRVLGVTAAQRGRALSSHSPQHDGERFRNVKPRPAEG
FT                   LRKTLGIVWNVLFNKPRGTVPTAALPIETLTRSQLDAAPDRSLYRLGHSTMLLKLRGQF
FT                   WLTDPVFAERASPFRHFGPKRFHAPPIALADLPPLRGVILSHDHYDHLDRETVLLLAQT
FT                   TGVFLTPLGVGDRLIEWGIDASKVRQFDWWQGTEVDGMQFTATPAQHFSGRSLFDGNST
FT                   LWASWVIVDDDLRVFFSGDTGYFDGFKTIGERLGPFDVTLVETGAYNEQWPYVHMQPEE
FT                   TVQAHIDLRGQWLVPIHNGTFDLAMHHWQEPFERVMGLALVHGVALSTPGMGERLDLSA
FT                   PHRGERWWRHAVEPAAAPKAAWRLCASRNVGDAKSS"
     atgacgtcgc ttcccgcctt tgtcagccgc gtgctcggcg ttaccgccgc gcaacgcggc        60
     cgcgcgttgt ccagccactc gccgcagcat gacggcgaac gctttcgcaa cgtcaagccg       120
     cgtcccgccg aaggcctgcg caaaacactg ggcattgtgt ggaacgtgct gttcaacaaa       180
     ccgcgcggca cggtgccgac cgccgcgttg ccgatcgaaa cgctgacgcg ttcgcaactc       240
     gacgcggcac cggaccgcag cctctaccgg ctcggtcatt caacgatgct gctgaagctg       300
     cgcggccagt tctggctgac cgatccggtg ttcgccgagc gcgcttcccc gtttcgccat       360
     ttcggcccga agcgctttca tgcgccgccg atcgcgcttg ccgatttgcc gccgctacga       420
     ggcgtgatcc tctcgcacga ccactatgac cacctggatc gcgaaaccgt gcttttgctt       480
     gcgcagacca ccggcgtgtt tctgacgccg ctcggcgtcg gcgaccggtt gatcgaatgg       540
     ggcatcgacg cttcgaaggt acggcagttc gactggtggc aaggcactga ggtggacggc       600
     atgcaattca ccgccacgcc cgcgcagcac ttttcgggtc gcagcctgtt cgacggcaac       660
     agcacgttat gggcgtcgtg ggtgatagtc gacgatgatc tgcgcgtgtt cttcagcggc       720
     gacactggct acttcgatgg gttcaaaacc atcggcgagc gcctcggacc attcgatgtc       780
     acactggtcg agaccggtgc atacaacgaa cagtggccgt acgttcatat gcagcccgaa       840
     gaaacggtgc aggcgcacat cgatctgcgc ggccagtggc tcgtgccgat tcacaacggc       900
     accttcgacc tcgccatgca ccactggcag gagccgttcg aaagggtgat ggggctggct       960
     ctcgtgcacg gtgtcgcgct gtctacgccc ggcatgggcg agcggctgga tctgagcgcg      1020
     ccacatcgcg gcgaacgctg gtggcgccac gccgtcgagc cagcagccgc gccaaaggcc      1080
     gcctggcggc tgtgtgcttc gcgcaatgtc ggagacgcga agtcttcgtg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page