(data stored in ACNUC7421 zone)

EMBL: CP000271.PE377

CP000271.PE377       Location/Qualifiers
FT   CDS_pept        complement(430260..430655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2648"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33345"
FT                   /db_xref="GOA:Q13RE4"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE4"
FT                   /protein_id="ABE33345.1"
FT                   /translation="MQDAAASAHHASLSAMVKAVVAAFVKAKTQNLDESRALYAVALEL
FT                   DSRSYVREVEARNRAALEAMLKTASDADFDDVPMTTFMFMGAMVGPIRLLLEAKSPQSM
FT                   IRKFRVQLESLCLGYLEREAYPKRSTD"
     atgcaagatg ccgctgcgtc agcgcaccac gcctctttat cggcaatggt gaaggctgtt        60
     gttgcggcat tcgtgaaagc aaaaacccag aatctggacg aatcgcgtgc tctatacgcg       120
     gttgccctcg aactcgattc acgcagctat gttcgcgaag tggaggcgcg caaccgcgcg       180
     gcgctggaag ccatgctgaa gacggcttcg gatgcggatt ttgacgacgt tcccatgacc       240
     actttcatgt tcatgggagc aatggtcggt cccatacgtt tgctgcttga agcgaagtcg       300
     ccgcaatcaa tgatccgcaa gtttcgcgtc caactcgagt cgctctgtct cgggtatctg       360
     gaacgcgagg cgtatccaaa gcgttcaacg gattag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page