(data stored in ACNUC7421 zone)

EMBL: CP000271.PE38

CP000271.PE38        Location/Qualifiers
FT   CDS_pept        40072..40671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2990"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33006"
FT                   /db_xref="GOA:Q13SD3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD3"
FT                   /protein_id="ABE33006.1"
FT                   /translation="MLSVSAIALLAFGIVVVLITPGPTNTLLAAAGLRQGVRRSLRLIA
FT                   AELGGYVISISVWGHFLVKAAHALPWLPSLVRVAAGLYIAYLAVDMWRAAVALSDSAQQ
FT                   ASGMRTLFVATLLNPKGLLFAGTIFPAIAFAQLPAYAFAMLMLACLLVPIALAWITFGA
FT                   ALGSGKLTWLNPVKMQRGASIVLGVFSLSLAWAALH"
     atgctctctg tgtctgctat cgcgttgctg gccttcggca ttgtcgtcgt gctgattacg        60
     cccgggccga ccaatacgct gcttgcggcg gccggtttgc gccagggcgt gcggcgctcg       120
     ctgcggctga tcgccgccga actgggcggc tatgtcatct cgatctcggt gtgggggcat       180
     ttcctcgtca aggcggcgca tgcgctgccc tggttgccct cgctggtccg cgtggcggcc       240
     ggtttgtaca tcgcctatct tgccgtcgac atgtggcgcg cggcagtcgc attgtccgac       300
     tcggcgcagc aggcgagcgg catgcgcaca ttgttcgtgg cgacgctgct caatccgaaa       360
     ggcctgctgt tcgccggcac gatctttccg gctatcgcct tcgcgcaact gcccgcctac       420
     gcgttcgcga tgctgatgct cgcgtgcctg ctggtgccga tcgcgctcgc gtggatcacg       480
     ttcggggcgg cgctcggcag cggcaagctc acctggctga atcccgtgaa gatgcagcgc       540
     ggcgcttcca tcgtgctcgg cgtgttttcc ctgtcgctgg cgtgggcggc gctgcattga       600
//

If you have problems or comments...

PBIL Back to PBIL home page