(data stored in ACNUC7421 zone)

EMBL: CP000271.PE380

CP000271.PE380       Location/Qualifiers
FT   CDS_pept        complement(431935..432153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2645"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2645"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33348"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RE1"
FT                   /protein_id="ABE33348.1"
FT                   /translation="MFPEFRDLISRLKTEDAHFSRLFDRHNELDHQISNMETGVTPSDN
FT                   SAIEALKKEKLQLKDELYAVLKKASAA"
     atgttccccg aatttcgcga cctgatttcc cgcctcaaaa ccgaagacgc tcatttctcg        60
     cggctcttcg accgtcacaa tgaactggac caccagatca gcaacatgga aacgggcgtc       120
     accccttccg acaactccgc tatcgaagca ctgaagaaag aaaagcttca gctcaaagac       180
     gagctctacg ctgttctgaa gaaagcctcc gcagcgtaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page