(data stored in ACNUC7421 zone)

EMBL: CP000271.PE382

CP000271.PE382       Location/Qualifiers
FT   CDS_pept        complement(433967..435898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2643"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2643"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33350"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD9"
FT                   /protein_id="ABE33350.1"
FT                   /translation="MGQRSLLLPGWIKAALSANDRLKLYLSVLQVAFAHAEHPDGELPD
FT                   LTAELVAAHVDAPWLRDMPASASLMDGTLLLPDLTRLVQRLAEDLETMARPLLQPDEPA
FT                   NALHARVQHWLDELGTLRGERLDRPQLQSLTRGQRTNGDDSLHLLVMDLHHALNQLAGT
FT                   ISSEEIDGAHVWQLQPDDRARVVAFMRGLNRTAPLKFDHPGLDTAATRDGERLLVQNDI
FT                   GTNDVHVLVVQIEGLTITLSYSDLHRPRFAFFQSLLVPYGAKWSDLQSKVNAALNEGDA
FT                   YTFGVARFDCADERALETTLEGIGSRIVFLIDWNRARKRLLSFVDKDHAIEVLREAVRL
FT                   EAGHMAWLKAGGEELIYAAMQAVGQGAFRIGDRLDTVLGATDAQAFMVEVLQMASHALL
FT                   GGQPVALVADQTRLLLARRVHQHSSAFELLEEHAGYCHALAQAVSDGLTHDIMSAPPAG
FT                   ESPTQALAARAKAWERRADHLVMRAREQAQRQPRWQPFKHLLELSDDIADALEDAAFLM
FT                   SLIADGHQQGWDRNVHESLSRLAQTVLMATQEHVKSLAIARCLGSASDTIDSDAFLAAS
FT                   WNVLRSERQCDELLRAARRAILAVVRDAAALMLANDLANTLELASDRLLVAGYALRDVA
FT                   FGETGANT"
     atgggacagc gcagcctgct gctgccaggc tggatcaagg cggcgctgtc tgccaacgac        60
     cgcctgaagc tctacctgag cgtgctgcag gttgccttcg cgcacgccga acatcccgac       120
     ggcgaattac cggatctgac cgctgagctt gtcgccgcgc acgtcgatgc gccctggctt       180
     cgggacatgc cggcgagcgc ctcgctgatg gacggcacgc tgctgttgcc tgatctcaca       240
     cgtctcgtac agcgtcttgc cgaagatctg gagacgatgg cgcggccact ccttcaaccg       300
     gatgagccgg caaacgcatt gcacgcgcgt gtccagcact ggctggacga actcggtacg       360
     ctgcgcggcg aacgcctcga ccgcccgcaa ttgcaatcgc tgacgcgcgg ccagcgcacc       420
     aatggcgacg acagcctgca tctgctggtg atggacctgc accatgcgct caaccagttg       480
     gcgggtacga tctccagcga ggagatcgat ggcgcacatg tgtggcaact gcaaccggac       540
     gatcgcgcgc gcgtcgtcgc gttcatgcgc gggctgaatc gcacggcgcc gctcaagttc       600
     gatcatcccg ggctcgacac cgccgcgacg cgcgacggcg agcggctgct ggtgcagaac       660
     gacatcggca ccaatgacgt ccatgtgctg gtcgtgcaga ttgaaggcct gacgatcacg       720
     ctgagttatt cggatctgca ccggccgcgc tttgcgttct tccagtcgct gctcgtgccg       780
     tacggtgcga agtggagcga cctgcagtcg aaagtgaatg ccgcgctgaa cgaaggcgat       840
     gcatacacgt tcggcgtcgc gcgcttcgat tgcgccgacg agcgcgcgct cgaaaccaca       900
     ctcgaaggaa tcggatcacg catcgttttc ctgatcgact ggaacagggc tcgcaagcgg       960
     ctgctttcgt tcgtcgacaa agaccatgcc atcgaggtct tgcgcgaggc agtccggctc      1020
     gaagccggcc acatggcctg gttgaaggcc ggtggcgaag agctcatcta cgctgcaatg      1080
     caagccgtcg gccaaggggc gtttcgcatc ggcgaccggc tcgacacggt acttggcgcg      1140
     accgatgcgc aggcattcat ggtcgaagtg ctacagatgg caagtcacgc cctgctcggc      1200
     gggcaacccg tggcgctcgt cgccgatcag acgcggttgt tgctcgcgcg gcgtgtgcac      1260
     cagcacagca gcgcgttcga actgctggag gaacacgcgg gttactgcca tgcgctcgca      1320
     caagcggtca gcgacggcct gacgcacgac atcatgtccg cgccgccggc gggcgagagc      1380
     cccacgcagg cgctggccgc ccgagccaag gcatgggagc ggcgggctga ccacctggtg      1440
     atgcgcgcgc gtgagcaggc gcagcgtcaa cctcgctggc agccgttcaa gcacctgctc      1500
     gaactctccg acgacattgc cgacgcactc gaagacgctg cgttcctgat gagcctgatc      1560
     gccgacggtc atcagcaagg ctgggaccgc aatgttcacg aatcgctgtc gcgtcttgca      1620
     caaaccgtgc tgatggcgac gcaggagcac gtcaagtcgc tcgccattgc gcgctgcctc      1680
     ggtagcgcga gcgatacgat cgacagcgat gcctttctgg ccgcgtcgtg gaacgtgctg      1740
     cgttcagagc gtcagtgcga cgaactgctg cgcgcggcac gccgcgccat tctcgccgtc      1800
     gtacgcgacg ccgctgcatt gatgctcgcc aacgacctcg cgaacacgct cgaactggcc      1860
     tcggatcgtc tgctggtggc cggttacgcg ttgcgcgacg tcgcgttcgg tgaaaccgga      1920
     gcgaacacat ga                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page