(data stored in ACNUC7421 zone)

EMBL: CP000271.PE388

CP000271.PE388       Location/Qualifiers
FT   CDS_pept        443836..444579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2637"
FT                   /product="ABC sulfonate transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2637"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33356"
FT                   /db_xref="GOA:Q13RD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13RD3"
FT                   /protein_id="ABE33356.1"
FT                   /translation="MSIDFALPQDAAIPAAAEERVNRTPLAVSVRGLQRRYGARVVIDA
FT                   LDLDIREGEFVTLLGESGCGKTTLLRALAGLDQPDAGQIRAPERPSVVFQEHRLLPWAT
FT                   LWENVVLGHETTIGRVGATRALAEVGLSGREDDWPRNLSGGQAQRVALARGLVRDPALL
FT                   LLDEPFAALDALTRIKMHGLVKELVARHHPGVLLVTHDVDEALTLADRILVMRSGRIAA
FT                   SFHPKNHTPQALRPILLEELGVQSH"
     gtgagcattg attttgcact gccccaggat gccgctattc cggccgccgc cgaagagcga        60
     gtaaaccgca caccgctcgc cgtttcggtg cgtggtttgc agcgccgcta cggcgcgcgt       120
     gtcgttatcg acgcgctgga cctcgatatc cgcgaaggcg aattcgtcac gctgctcggg       180
     gaaagcggat gtggcaagac cacgctgttg cgtgcgctgg ccgggctcga tcagcccgac       240
     gccggccaga ttcgcgcgcc cgaacgccct tccgtcgtat tccaggaaca ccggctacta       300
     ccctgggcga cgctgtggga gaacgtcgtg ctcggtcatg aaacgacgat tgggcgtgtg       360
     ggcgcgacgc gcgcgttggc cgaagtcggg ctttccggtc gcgaggacga ctggccgcgc       420
     aatctctccg gaggtcaggc gcaacgcgtg gcgttggcgc gcggcctcgt tcgcgaccct       480
     gccttgctgc tgctcgatga accgttcgcc gcgctcgacg cgctcacgcg gatcaagatg       540
     cacggactcg tcaaggagct ggtagcgcgc catcaccccg gcgtgctgct cgtgacgcat       600
     gacgtggacg aagcgctcac gcttgccgac aggattctcg tgatgcgctc ggggcgcatc       660
     gcggcttcct tccaccccaa aaaccacacg ccgcaggcac tgcggccgat cctgctcgaa       720
     gagctcggcg ttcagtctca ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page