(data stored in ACNUC7421 zone)

EMBL: CP000271.PE389

CP000271.PE389       Location/Qualifiers
FT   CDS_pept        444616..445620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2636"
FT                   /product="ABC sulfonate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2636"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33357"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RD2"
FT                   /protein_id="ABE33357.1"
FT                   /translation="MNDSSLSRRQLLRAAGGLLAGAAASSLFPVRAAEPRKLTRNTDTV
FT                   RVGWGYGSLPDIARQRGVFEKTLAAKGIEVEWVGPFPNHAPSIQAVVGGSADFGFWGST
FT                   TPALAAMLAGSPLVFNAFDIYSPRSTAIIVKKTSGINSVADLVGRKVAINRSGLGEFLL
FT                   IAALEKNHIDRSKVEFVYLNPPDAAPAFAQGVVDAWSMWSPAVDIARYSNNAKDIFNEG
FT                   RDLDFLIDYSSLVTRRKFTEENSELIRAVIDAYYVEGAWQSAHSAESEQLVQREAKYPD
FT                   QVRDYLTSLKRVNQFHEPDDAAFIAQFQRAADWLAERKIINSRIKVADYSVKV"
     atgaacgatt cttcactgag ccgccgccaa ctgctgcgcg cggcgggtgg cctgctggcc        60
     ggcgctgccg ccagcagcct gtttccggtt cgcgcggccg agccgcgcaa gctgacacgc       120
     aacaccgata cggttcgcgt cggctgggga tatggcagcc tgccggacat tgccaggcag       180
     cgcggcgtgt tcgaaaagac gctggctgca aagggcatcg aggtcgaatg ggtcgggccg       240
     ttcccgaatc atgcgccttc gattcaggca gttgttggcg gcagcgcgga tttcggcttc       300
     tggggatcga caacgccggc actggccgcg atgctggccg gctcaccact cgtgttcaat       360
     gcgttcgaca tctattcgcc gcgctcgact gcgatcatcg tgaagaaaac gagcggcatc       420
     aattcggttg ccgatctcgt gggccgcaag gtcgcgatca accggtcggg actgggcgaa       480
     ttcctgctga ttgcagcgct ggagaagaat catatcgacc gcagcaaggt cgagttcgtc       540
     tacctgaatc cgcccgatgc cgcgccggcg tttgcgcaag gcgtagtcga cgcctggtcg       600
     atgtggtccc cggccgtgga tatcgcgcgc tatagcaaca acgccaagga catttttaac       660
     gaaggacgcg acctcgattt cctgatcgat tacagctctc tcgtgacgcg ccggaaattt       720
     accgaagaga attccgagct gattcgcgcg gtgatcgatg cgtattacgt cgaaggcgcg       780
     tggcagtcgg cgcattccgc cgaatccgaa cagctcgtgc agagggaagc caaatatccg       840
     gatcaggtgc gcgactatct gaccagcctg aaacgcgtga atcaattcca tgaacccgac       900
     gacgccgcat tcatcgcgca gttccaacgc gccgccgact ggcttgcgga acgcaagatc       960
     atcaactcgc gaatcaaggt cgcggattac agcgtcaagg tttga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page