(data stored in ACNUC7421 zone)

EMBL: CP000271.PE39

CP000271.PE39        Location/Qualifiers
FT   CDS_pept        complement(40692..41942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2989"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2989"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33007"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD2"
FT                   /protein_id="ABE33007.1"
FT                   /translation="MKTLSLSAARTLHLAAQGLLTPPRRKAVKADVLDAIRRMAQLQID
FT                   TIHVVARSPYLVLFSRLGAYPQQWLDEHLAEGKLFEYWSHEACFVPTEDYGLLRHRMLD
FT                   PSGMGWKYAAEWHKKHRKDIEKLLAHIRATGPVRSADFAREAGKGNGWWDWKPEKRHLE
FT                   VLFAIGQLMVAERRNFHRVYDLTERVLPDWDDARDLPPAHTVTEEVLRRTCRALGVARA
FT                   DWVADYYRLPRRPYRDELHALADQGELIPVRVEGWKQDTFVHRDFAPILDDAASGKLTS
FT                   TVTTVLSPFDPVVWDRKRAAALFDFDYAIECYTPAAKRKYGYFVLPLLSRGRLVGRVDA
FT                   KAHRTQGVFELKSLHIEPGVRLSARLAGDLRRALQRCADWHGTPQLEITAAPPEWLDAL
FT                   SVEDVSNEVRLRAGVAA"
     gtgaagactc tttcgctttc cgccgcccgc accctgcatc tggccgcgca aggtctgctg        60
     acgccaccgc gccgcaaggc cgtcaaggcc gacgtgctcg acgcgatccg ccgcatggca       120
     cagttacaga tcgacacgat ccatgtggtt gcgcgcagcc cgtacctcgt gttgttcagc       180
     cggctcggcg cttatccgca gcagtggctc gacgagcatc tcgccgaggg caagctgttc       240
     gagtactggt cgcacgaggc ctgtttcgtg ccgaccgaag actacgggct gctgcgccat       300
     cgcatgctcg atccgagcgg catgggctgg aaatacgcgg ccgagtggca caagaagcat       360
     cgcaaggaca tcgagaaact gctcgcgcac atccgcgcga ccggcccggt acgctcggcg       420
     gatttcgccc gcgaggcggg caaaggcaac ggctggtggg actggaagcc ggagaaacgc       480
     catctggaag tgctgttcgc gatcggacaa ttgatggtgg ccgagcgacg caattttcac       540
     cgcgtctacg atctgaccga acgcgtgctg ccggattggg acgacgcacg cgatctgcca       600
     cctgcgcaca ccgtgaccga agaagtgttg cgccgcacct gccgtgcgct cggtgtcgcg       660
     cgcgccgatt gggtcgcgga ctactaccgc ttgccgcgcc ggccgtaccg cgacgaactg       720
     catgcgctcg ccgaccaggg cgaactgatt ccggtgcgcg tggagggctg gaagcaggac       780
     acgttcgtcc atcgtgactt cgccccgatc ctcgacgatg ccgcgagcgg caagctcacc       840
     tcgacggtga ccacggtgtt gtcgccgttc gatccggtgg tgtgggaccg caagcgcgcc       900
     gctgcgctct tcgacttcga ctatgcgatc gaatgctata cgcccgctgc gaagcgcaaa       960
     tatggttact tcgtattgcc gctgctgagc cgcgggcgtc tggtcggccg cgtggatgcc      1020
     aaggcgcatc gaacccaggg cgtgttcgaa ctgaagtcgc tgcacatcga accgggcgtg      1080
     cgactgagcg cccgtcttgc cggcgatctg cgccgcgcac tgcaacgctg cgcggactgg      1140
     cacggcacgc cgcaactcga aatcaccgcc gcgccgccgg aatggctcga cgcgctaagc      1200
     gtagaagacg tctcgaatga agtccgcttg cgcgccggcg tggctgcctg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page