(data stored in ACNUC7421 zone)

EMBL: CP000271.PE393

CP000271.PE393       Location/Qualifiers
FT   CDS_pept        complement(450503..450799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33361"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC8"
FT                   /protein_id="ABE33361.1"
FT                   /translation="MWREQLGALKGLIRQVSKSETDPMLEVDTVAEKNYYVRQEVKMRI
FT                   LDARSKLQLVDDKTGQDGGKESKLTVAPTAEGSAAKWRSFVECRGGFWSSSPA"
     gtgtggagag agcaactggg tgcgctaaaa ggtttgattc gacaggtgtc aaagtcggag        60
     accgatccaa tgcttgaagt tgatacagtg gcggagaaaa actactacgt ccgacaagag       120
     gtcaagatga ggatcctaga tgcgcgtagc aagctgcagt tggtcgacga caagaccggt       180
     caggatggcg ggaaagaatc gaaactgacg gttgcgccga ctgccgaggg tagtgcggcg       240
     aagtggcgtt catttgttga gtgtcgcggc ggattctggt catcatcgcc cgcgtag          297
//

If you have problems or comments...

PBIL Back to PBIL home page