(data stored in ACNUC7421 zone)

EMBL: CP000271.PE394

CP000271.PE394       Location/Qualifiers
FT   CDS_pept        451060..451521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2631"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33362"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC7"
FT                   /protein_id="ABE33362.1"
FT                   /translation="MSKTAKNQPASRPPVDALQYEKLALSAFDLCERQLGKLNTLITLA
FT                   SSMCRNPAVTSDERRRRQTMLELLVDTAEQYHQDLECERELFQVIALDAKGVPQARLTA
FT                   SHATRLLVEASRIANGSQATDNAPKRKRSPAKSVAIAKAHAQQSVAVQH"
     atgagcaaga ccgcaaaaaa tcaacccgct tcacgcccgc ctgtcgatgc actccaatac        60
     gaaaagctcg cgctgtccgc attcgaccta tgcgaacggc aactgggcaa actgaatacg       120
     ctaatcacac ttgcgtcttc aatgtgtagg aatcctgccg tcacgagcga cgaaagacga       180
     cgccgtcaga ccatgctcga attgctcgtc gacacggccg agcaatatca tcaggatctc       240
     gaatgcgaac gcgaactctt ccaggtgatt gcgctcgatg caaagggcgt ccctcaagcg       300
     cgtctcaccg ccagccacgc aacgcgcctt cttgtcgaag catccaggat tgcgaacgga       360
     tcgcaagcta ccgacaacgc ccccaagcgc aaacgttctc ctgccaaaag cgtggcgatt       420
     gcaaaggcgc acgcacagca atcggtcgcc gtgcagcact aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page