(data stored in ACNUC7421 zone)

EMBL: CP000271.PE396

CP000271.PE396       Location/Qualifiers
FT   CDS_pept        452936..453286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2629"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33364"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC5"
FT                   /protein_id="ABE33364.1"
FT                   /translation="MRDLWCLCVQSVDDCCLTLFDAWCERRAVIPLCYLLNVWPIVSAS
FT                   GSAICRLYAILDEILSNEAEGLMDRERKIINTILRNKCTLVEGLPAGVANAVCDVCSNR
FT                   RYEVTLFDGGVV"
     atgcgtgatc tctggtgttt atgcgtccag tcagtcgatg actgttgtct gacgttgttc        60
     gacgcatggt gcgaaaggcg cgcggtaata ccgctgtgct acttgttgaa tgtgtggccg       120
     atcgtgtctg cgtctggttc tgcgatatgt cgactctacg caatattgga tgaaatattg       180
     agcaacgagg ctgaagggtt gatggacaga gaacgtaaaa taatcaacac gatcctgcga       240
     aataaatgca cccttgttga aggtttgccg gccggggtcg ccaatgcggt gtgtgatgtc       300
     tgttcgaatc ggcgctatga agtaacgcta tttgatggcg gcgttgtcta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page