(data stored in ACNUC7421 zone)

EMBL: CP000271.PE398

CP000271.PE398       Location/Qualifiers
FT   CDS_pept        455303..457474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2627"
FT                   /product="GAF sensor diguanylate phosphsdiesterase (EAL
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2627"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33366"
FT                   /db_xref="GOA:Q13RC3"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC3"
FT                   /protein_id="ABE33366.1"
FT                   /translation="MAMSNDVSDATPDNDLMDDGSHLYSQARASALTSLTEVLRHNAVE
FT                   IVKRFYDGLIRLPKSKHTLAALSEHELQHLKTQQIQNLYALASPDLTAMDHRTMALRVG
FT                   RIHAIVGLEWEDLIRSRGILSAAIHDTLDTTVHGIALAVLGRRLTQDLAWQTEAYQRLQ
FT                   TSRQDVLMRVTQLAWEVESYTDLIGRVVQILGEHDEVTGCSVGRPDSDGVFRFESVSGK
FT                   SMERYLAELENSTERPVSNGDLPQGQGPVGRAWRSGNVERSINFATDPLMEPWRALALY
FT                   ENFRSSVAIPLRQPGHPPKAILSLYSAFPGGYSAADQMAFIMPLQTLLGLAIARIENQE
FT                   GRTHAVPYATRQHWAALLRSDALEMHYQPLLDLKTGHVTKVEALARLREGDRVLTPGEF
FT                   FPALSTDDFLELYVRGLAQVLSQRNRWLQVGVELKVSVNLPSSAMGDNRYFEATRQALT
FT                   EYFCRPDMLTLEILETDALPSGMDVSGELAKFKLLGINLAEDDLGSGHSSLNRLRELPF
FT                   DWIKIDRSIVSVAGQDASNVLRFVYQLTRLGRSLGKSVVVEGIEDAGMLEAIVILGADV
FT                   AQGYAIARPMNAQQLTAWMHKQPHVPRYLEARSALGKLAALLIWEERLHLICEDPRAFG
FT                   RLSDIVTVPVTPGVVPPAVPAPLDSACQVCPFSRFFSETDSILPKGLSDPTAQRALIAA
FT                   AVRHGPDSVAYRSARQRLVTAIMSETAEH"
     atggccatgt cgaacgacgt ttccgacgca acgcctgaca acgatctgat ggacgatggt        60
     tcgcatctgt acagccaggc acgggcgtcg gcactcacct ccctgacgga ggttttgcgg       120
     cacaacgctg tcgagattgt gaagcgcttc tacgatggcc tgattcgtct gcccaaatcg       180
     aagcacacgc tggcggcgct ttcggaacat gaacttcagc atctcaagac acaacagatc       240
     cagaatctgt acgcgctcgc gtcaccggat ctgaccgcga tggatcaccg tacgatggcg       300
     ctgcgagttg gacgtatcca tgccatcgta ggattagagt gggaagatct gattcgcagt       360
     aggggcatcc tgtccgcagc gattcacgac acactcgata cgacagtgca cggaatagcg       420
     ctggcggtgc tgggaaggcg cctgacgcag gatctggcgt ggcagacgga ggcctaccag       480
     cgtctgcaga cttcgcggca agacgtgttg atgcgcgtga ctcagctcgc gtgggaagtg       540
     gagagctata cggatctgat cggccgcgtt gttcagatac tcggtgaaca tgacgaggtg       600
     acaggctgtt cggttggccg gcccgatagt gacggggtct ttcgtttcga gtcggtgtca       660
     ggcaagtcga tggagcggta tcttgccgag ttggagaatt ccacggagcg gccggtctcg       720
     aatggcgatc taccgcaggg gcagggacca gtcgggcgcg cctggcgtag cgggaacgtg       780
     gagcgaagca tcaactttgc aacggatccg ctaatggagc cgtggagagc gctggcgctg       840
     tacgagaact tccgctccag cgtggcgatt cctttgcggc aacccgggca tccgcccaag       900
     gccatcctct cgctgtatag cgcgtttcca ggcggctatt cggcagcaga ccagatggct       960
     tttatcatgc cattgcaaac gcttctgggg ctcgcaatcg cgcggatcga gaatcaggaa      1020
     gggcgcactc atgccgtacc gtacgccacg cgacaacatt gggcggcgct gctccggtcc      1080
     gatgcgctgg aaatgcacta ccagccgcta ctggatctta aaaccgggca tgtgaccaaa      1140
     gtcgaggcgc tggcccggct gcgcgaaggc gatcgggtcc tgacgcccgg cgagtttttc      1200
     ccggcactat ccacggatga tttccttgag ctctacgttc gcggactcgc acaggtgttg      1260
     tcccagagga accgctggtt gcaggttggc gtcgagttga aagtgtcggt caatctgccg      1320
     tccagtgcga tgggcgacaa ccgctatttt gaagcgacac ggcaagcgtt gacggaatac      1380
     ttttgccgtc ctgacatgct gacgctggag attctggaaa cggatgcgct tccatccggt      1440
     atggacgtat ccggcgaact ggcgaaattc aagttgctcg gcatcaatct ggccgaagat      1500
     gatctcgggt ccgggcacag cagcctgaac cggttacgcg aactgccgtt cgactggatc      1560
     aagattgacc gcagtatcgt gagtgttgcc ggtcaggacg cgtcgaacgt gttgcgtttc      1620
     gtctatcaat tgacgcggct tggccgctcg ttgggtaaat cagtggtggt ggaagggatt      1680
     gaagatgcgg gcatgctcga agcgatcgtc attctcggcg cggatgtcgc gcagggctat      1740
     gcaatcgcgc gccccatgaa tgcacagcag ttgacggcgt ggatgcataa gcagcctcac      1800
     gtaccgcgat atctggaagc gagaagcgcg ttgggtaagc tggccgcgct gctgatctgg      1860
     gaagagcggc tgcatctgat ttgtgaagat ccgcgagcgt tcggcaggct gtctgatatc      1920
     gtaacggtgc ccgtcacgcc cggagtcgtc ccaccggctg tgccggcgcc gctcgactcg      1980
     gcctgtcagg tttgcccatt ctcaaggttt tttagcgaaa cggattcgat tctgccaaag      2040
     ggactgtcgg atccgacagc acagcgagcc ctgattgcgg ctgcggtgcg tcatgggccg      2100
     gatagcgtgg cctatcggtc ggcgcgccag cggcttgtga ccgctatcat gagcgaaacg      2160
     gccgaacact ga                                                          2172
//

If you have problems or comments...

PBIL Back to PBIL home page