(data stored in ACNUC7421 zone)

EMBL: CP000271.PE399

CP000271.PE399       Location/Qualifiers
FT   CDS_pept        457587..459362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2626"
FT                   /product="periplasmic sensor diguanylate cyclase (GGDEF
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2626"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33367"
FT                   /db_xref="GOA:Q13RC2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC2"
FT                   /protein_id="ABE33367.1"
FT                   /translation="MIRKAFSAMSIDRRFGISVAAALLPVLLLCGRLVVHEWHAYMVAD
FT                   DALYAFQTYRAGLLAIESVSAERGPTNSVLGENLPIPEARRASLLRARGESDARIEKLL
FT                   EMLQSSRCPGCATELARIENARAELTGARANVDQLIGLPLAQRRERALSSAVDRMIKVI
FT                   PQFSPVIDALAANVVRGDTRALNCLILATLTADLREAAGQLGSHFTAALTARRALGEGD
FT                   QLAIERTEGRIDQLRELIDSHIRDRSMLESAPFDRMNRQYFGEGMAYITDVRSLATRPG
FT                   GVAISPAQLADHYVPMMRPITAFRDQVLDLADTEIRFHRSNALGLLAVSALAAFLLIMI
FT                   LLSMAMLFRRRVIRPLVDATHVIGAIANGDLTAEIPAARYRGEIKAMFNAIGVLKANSV
FT                   ERQQLERERGRLIQELKATAETDFLTHLLNRRAFESRARLSCAERNAAEPELALIMFDI
FT                   DHFKKINDTYGHATGDHALQLVARLCRETCRQADVVARWGGEEFAVLSRVQDAAQALAV
FT                   AERLRCRIRETRIPVSGGDGFNITASFGVAFASACDSRDVDRLFRRADRLLYQAKEAGR
FT                   DRIFADPTSVASDNA"
     atgatcagga aagcattctc cgccatgtcc atagacaggc gcttcggtat cagtgttgcc        60
     gccgcgctcc ttccggttct gcttttgtgc ggcaggctgg tcgtgcacga gtggcatgcg       120
     tacatggtgg ccgacgacgc gctctatgcg ttccagacct atcgcgccgg attgctggca       180
     atcgagagcg tgtccgcgga gcgtggcccg accaatagcg tgctaggcga aaatttgccg       240
     atccccgagg cgagaagggc gtcgctgctt cgcgcccgtg gcgagagtga tgcgcggatc       300
     gagaagttgc tggagatgct tcaatccagc cgttgtccgg ggtgtgccac cgagcttgca       360
     cgcatagaga atgcgcgcgc cgaacttaca ggcgcacgcg cgaacgtcga tcaactcatt       420
     ggcctgccgc tggcacagcg gcgggagcgt gcgctatcga gcgcagtgga ccgcatgatc       480
     aaggtcattc cgcaattctc gccggtcatc gatgcattgg ccgcaaacgt ggtcaggggc       540
     gatactcgtg cgctgaattg tctgatcctc gctacgctga ccgctgacct gcgggaagct       600
     gccggccagc tcggctcgca ctttaccgcc gcgctgaccg cacgcagggc gctcggtgaa       660
     ggcgatcagc ttgctatcga gcgcaccgag gggagaatcg atcagttgcg cgaattgatc       720
     gattcgcata tccgggaccg gtcgatgctg gagtccgcgc cattcgaccg aatgaaccgg       780
     cagtacttcg gcgagggtat ggcctatatt accgacgtcc gcagcctcgc gacccggccg       840
     ggcggcgttg cgatatcacc tgcgcagctc gcggaccact acgtgccgat gatgcgtcca       900
     attacggcgt tccgcgatca ggtgctggat cttgctgata cggaaatccg ttttcatcgc       960
     agcaatgcat tgggtcttct ggcggtcagc gcactggccg cctttctgct gatcatgatc      1020
     ctgctctcga tggcgatgtt attcagaagg cgcgtgattc gaccgcttgt cgatgcgacc      1080
     catgtaattg gagcaattgc aaacggcgac ctcacggcgg agattccggc agcgcgctat      1140
     cgcggcgaga tcaaggccat gttcaatgcg atcggtgtgc tgaaggcgaa tagtgtggag      1200
     aggcagcagc tcgaacggga gcgtggccgt ctgattcagg aactcaaagc cacggcggaa      1260
     acggactttc tgactcatct gctcaaccgc cgcgcattcg aaagccgggc gcgcctgagc      1320
     tgtgctgaac ggaacgcggc cgagcccgag ctcgcgctga tcatgttcga cattgaccac      1380
     ttcaagaaga tcaacgacac atatggtcac gccactggcg atcatgcgct acagctcgtg      1440
     gcgcgccttt gccgtgaaac ctgccggcaa gcggatgtcg ttgcgagatg gggtggggaa      1500
     gagttcgccg tgctgagccg tgtgcaagat gcggcccagg cgcttgccgt agcggagcgt      1560
     ttgcgttgca ggatcagaga gacgcgaatt cctgttagcg gtggagacgg tttcaacatt      1620
     accgcgagct ttggcgtcgc cttcgcatca gcgtgcgatt cgcgcgacgt ggatcgtctt      1680
     ttcaggcgcg ccgatcgtct gctgtatcag gcaaaagagg ccgggcgtga tcgtatcttt      1740
     gccgatccga ccagcgtggc cagcgataac gcctga                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page