(data stored in SCRATCH zone)

EMBL: CP000271.PE4

CP000271.PE4         Location/Qualifiers
FT   CDS_pept        5826..6899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32972"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG7"
FT                   /protein_id="ABE32972.1"
FT                   /translation="MATVRDLTQTGSASDIPKDIDHFWERIRNVSRVKVGTGAIPKALE
FT                   ERAGELLGALFEEAVTHARATLDDEREEMRTQIAAADQRARDAEIRQQAAEDAIKRGEL
FT                   RAEAGWERVRALEAQLSSATTHGNTHQEGLQATVRRLDQENESLRQRLDTEFATNAALR
FT                   DRIDALHVELRQSTEHYAQQIKDAIAEAERRVKPMLVELDSLRSMAATYQSGLRDASRK
FT                   EFEFIQQIAAAKARGDRLDAQLREQSDEVDALTKEVAVLRSQQGVDPAIATLLCSLVEA
FT                   GRLTEDELKAIGTAVDGHVALPLRCPKCEEGEPELSQVDHRFELQCPECDHSSGLGESR
FT                   LEAVRRFQSSGPVAASA"
     atggccaccg tccgcgatct cacgcaaacc ggcagtgcaa gcgacatccc caaagacatc        60
     gatcatttct gggaacgcat ccgaaatgtg tcgcgcgtga aagttggcac cggcgctatc       120
     ccaaaagcac tggaagagcg tgcaggcgaa ctgctcggcg cacttttcga agaagccgtc       180
     acacacgccc gtgcaacgct cgatgacgag cgcgaggaaa tgcgtacgca aatcgccgcc       240
     gccgaccagc gcgcacgaga tgcggaaatt cgccagcagg cagcggaaga cgcgatcaag       300
     cgcggcgaac tgcgagcgga ggcgggctgg gaacgcgttc gcgcactgga agcacaattg       360
     tcgagcgcga ccacgcacgg caatactcac caggaagggc tacaggcaac ggtgcgccgt       420
     ctcgatcagg aaaacgagtc gcttcggcaa cgcctcgaca ccgaattcgc gaccaatgca       480
     gcattacggg accggattga cgcgttgcac gtcgaattgc gccaaagcac cgaacactat       540
     gcacaacaga tcaaagacgc cattgccgaa gccgagcgtc gcgtcaagcc gatgctggtc       600
     gaactcgatt ctttgcgcag catggcggcg acctatcagt ccggcctacg cgatgcgagc       660
     cgcaaagagt ttgagtttat tcagcaaatc gctgcggcca aggcgcgcgg cgaccgactc       720
     gacgcccaac tgcgcgagca atccgacgaa gtggatgcgt tgacgaaaga agtcgcagtc       780
     ctgcgtagtc agcaaggtgt cgatccggca atcgccaccc tgctctgttc actggtcgaa       840
     gccgggcggc tgaccgaaga cgaattgaag gcgatcggca ccgccgtgga tggccatgtg       900
     gcgttgccgc tacgatgccc aaaatgcgag gaaggtgagc cggaactgtc gcaagtggat       960
     caccgcttcg agttgcaatg tccggagtgc gatcactcgt cgggtctcgg cgagtcaagg      1020
     ctggaggcgg ttagacggtt tcagtcgagc gggccggttg ctgcatcggc atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page