(data stored in SCRATCH zone)

EMBL: CP000271.PE40

CP000271.PE40        Location/Qualifiers
FT   CDS_pept        complement(42064..42354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2988"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SD1"
FT                   /protein_id="ABE33008.1"
FT                   /translation="MFQRATLLAAIGLAAACASTAASARVDVGVFVNTPGPVYAAPPVY
FT                   AAPPVYAPPPVVYAPRPAYGYGYRDDYYRGRRWHHDHGRHRGWDRHHGRGW"
     atgttccaac gcgcaaccct tctcgccgcc atcggccttg ccgccgcctg cgcctcgact        60
     gccgcctcgg ccagggtgga cgtcggcgtc ttcgtcaaca cgccggggcc ggtgtacgcc       120
     gcgccgccgg tgtatgcggc gccgcctgtc tatgcgccgc cgccagtcgt gtacgcgcct       180
     cgaccggcct acggttacgg ctatcgggac gactactacc gcggccgccg ctggcatcac       240
     gatcatggcc gtcatcgcgg ctgggaccgg catcacggcc gcgggtggta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page