(data stored in ACNUC7421 zone)

EMBL: CP000271.PE400

CP000271.PE400       Location/Qualifiers
FT   CDS_pept        complement(459421..459723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2625"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33368"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RC1"
FT                   /protein_id="ABE33368.1"
FT                   /translation="MKSLIKAATLVVVLAVPLASFAQSEQPVTRAEVKAQLKQLEQAGY
FT                   NPAVATDAVYPADIQAAEARVSARNNAATAYGPSTAGSSETGSGVPAGNPNLQGQ"
     atgaaatcgc tcatcaaggc agcgacgcta gtcgtcgtgc tcgcagtccc gctcgcgtca        60
     ttcgcgcaat ccgagcaacc ggtcacgcgt gccgaagtca aggcacaatt gaagcaactc       120
     gaacaggccg gctacaaccc cgcggtagca accgacgccg tctatcccgc cgacattcag       180
     gccgccgaag cccgcgtttc cgcgcggaac aatgcagcga cggcatacgg cccttctacg       240
     gccggctcgt ccgaaaccgg ctccggcgtt ccggccggca atccgaatct gcaagggcaa       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page