(data stored in ACNUC7421 zone)

EMBL: CP000271.PE406

CP000271.PE406       Location/Qualifiers
FT   CDS_pept        466619..467818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2619"
FT                   /product="xylose ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2619"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33374"
FT                   /db_xref="GOA:Q13RB5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB5"
FT                   /protein_id="ABE33374.1"
FT                   /translation="MTPDVTSQRADEALPRGAFGGPQRLQQLFARYKILALLIAVAAIW
FT                   IFFSVLTHGAFVTPRNLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVAA
FT                   ILDVNRHWPLAVTLPVVMLLGVLIGMFNGWWSTYRRVPSFIVGLGGMLAYRGILLGVTG
FT                   GSTIAPVSDGFVFVGQGYLPRLAGDTLAVVLFVLLAFLTIRQRRNRERYQLRVVPVWQD
FT                   VVKVVGAGVILAGFVATLDRYGGIPVPVLLLLALLGIFTWIATQTVFGRRIYAVGSNLE
FT                   ATRLSGVNTNRVKLAIFALMGLMCAFGGIVNTARLAAGSPSAGSMGELDAIAACFIGGT
FT                   SMRGGSGTVYGALIGALVMASLDNGMSMLDVDAYWQMIVKGSILVLAVWIDVVSGSNRR
FT                   "
     atgacgcccg acgttacttc ccaacgcgcc gatgaagccc tgccgcgagg cgcattcggc        60
     ggtccgcagc gccttcagca actgtttgcg cgctacaaga ttctcgcgct gctgatcgcc       120
     gtggccgcga tctggatttt cttttcggtg ctgacgcacg gcgctttcgt tacgccgcgc       180
     aatctgtcga acctgctgcg gcagatgtcg attaccggca tgctcgcgtg cggcatggtg       240
     ttcgtgatca ttgccggcga gatcgatctg tcggtcgggt cgctactcgg tttgctcggc       300
     ggcgtggcgg cgatactcga cgtcaaccgg cactggccgc tcgccgtcac gttacccgtg       360
     gtgatgttgc tcggcgtgct gatcggcatg ttcaacggat ggtggtcgac ttaccggcgc       420
     gtgccgtcgt tcattgtcgg gctcggcggc atgctggcgt atcgcggcat tctgctcggc       480
     gtgacaggcg gctcgacgat tgcgccggtg tcggacggct tcgtgttcgt cgggcaagga       540
     tatctgccga ggctcgcggg cgatacgctt gccgtggtgc tgtttgtgct gctggcattt       600
     ctgacgatac ggcagcggcg aaaccgcgag cgttatcagt tgcgtgtggt gccggtttgg       660
     caggacgtcg tgaaagtggt gggcgcgggc gtgattctcg ccggctttgt cgctacgctc       720
     gaccgttacg gcggtattcc ggtgccggtc ctgttgctgc tcgcgctgct gggtatcttt       780
     acgtggatcg ccacgcagac ggtgttcggg cggcgcatct atgcggttgg ttcgaacctc       840
     gaagcgacgc gactctcggg cgtcaacacc aaccgcgtga aactggcgat tttcgcgctg       900
     atggggctga tgtgcgcgtt cggcggcatc gtcaatacgg cgcggcttgc tgccgggtcg       960
     ccttcggccg gatcgatggg cgagctcgat gctattgcgg cttgctttat cggtgggacg      1020
     tcgatgcgcg gtggttccgg cacggtctac ggtgcgttga tcggcgcact ggtcatggcg      1080
     agcctcgata acggcatgtc gatgctcgat gtcgatgctt actggcagat gatcgtgaag      1140
     ggcagcattc tcgtgctggc cgtgtggatc gatgtggtgt cggggtcgaa ccggcggtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page