(data stored in ACNUC7421 zone)

EMBL: CP000271.PE407

CP000271.PE407       Location/Qualifiers
FT   CDS_pept        complement(467845..469737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2618"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Tetratricopeptide repeat present"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2618"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33375"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB4"
FT                   /protein_id="ABE33375.1"
FT                   /translation="MHLRRSYAAQMHNFTHKRSWLSLKMPDATAHHSYVVDIDALIARA
FT                   DADYSALRMRDAESGYQRALALSPLNVHALHRMGLVCVHLKKIAEADTYLERALNADPA
FT                   RADLWEHAGLIAAIKGEYIRSEAFYRRALGLSGSTATLHRNLADCLRLSGRLADAKVQY
FT                   KKALSIEPDLHHAIRAIARLSAELGETDDAADYWLSAWALDSSSLQDGFDLIHALAKAN
FT                   RTVRVNEAVAQISKREADNPEALQALCLALYRVDSFANMLNVARQAIRMDPQRVALHHY
FT                   AAHALSVRGRVAEALVYSSEAVRLAPDDPVMQCQLACLELSQGDFKSGWARRNMTYAMP
FT                   LARATLVFPDFPVWNGEPVSGSSFLLVGEQGRGDEIQFIRFAEWLHQQGAVVDVLVSQP
FT                   VARIAASMTGVRSVFTKLPAGPYDYWSHMLRMPEHMKLDLPMLPVAMPYISASPLHVDQ
FT                   WRSRINAASPSTAYKKTARIGVVWAGGAHTALDRFRSISMEALKPLLEHPGTTWFSLQK
FT                   GEHERDSERLAGKFDLHTLGPVIEDFADTLAILETLDLLITVDTAVAHLAGAANLPVWV
FT                   LLPAYSELRWLTGRTDSPWYPSMRLFRQRELGEWNTVVEEMREALTDWCRTGPI"
     atgcatctgc gtcgctctta cgccgcgcag atgcacaact tcacgcataa gcgaagctgg        60
     ttatctttga aaatgcctga cgccaccgcc catcattcct acgtcgtcga catcgacgcc       120
     ctgattgctc gcgcggacgc cgactattcc gccttacgca tgagggatgc ggaaagcggc       180
     tatcaacgcg cattggccct aagcccgctc aacgtccatg ccctgcatcg tatgggactg       240
     gtgtgcgtgc acctgaaaaa aatcgccgaa gcagatactt atctggagcg tgctctaaac       300
     gccgatccgg cacgtgccga tctgtgggaa cacgcgggcc tgattgccgc gataaagggc       360
     gaatacatac gttcggaagc cttctaccgt cgtgcgctcg gcctctctgg aagcaccgca       420
     acgttgcatc gcaatctcgc ggattgcctg cgactcagcg gccgccttgc tgatgcgaaa       480
     gtgcaataca aaaaggctct ctccatagag ccggaccttc atcatgcgat acgtgccatc       540
     gcgcgtttga gtgccgaact cggggaaacc gatgacgccg ccgattattg gctatctgcc       600
     tgggcgctcg attcatcttc cctgcaagac gggttcgatc tgatccatgc gctagccaaa       660
     gccaatcgaa cggtgcgggt aaacgaagcg gtcgcacaga tcagcaaacg ggaagcggac       720
     aatcctgaag cattgcaggc gctgtgtctc gcgctataca gagtggacag cttcgccaac       780
     atgctgaatg tcgcccgcca ggcaatcagg atggatccgc aacgcgtcgc gctgcaccac       840
     tatgccgccc atgccctgag cgtacgcggc agagttgcag aagcgttggt ctacagcagc       900
     gaagcggtac ggctcgcgcc cgacgatcca gtcatgcagt gtcagcttgc atgcctcgaa       960
     ctgagtcagg gcgacttcaa gagcggatgg gcgcgtcgca atatgactta cgccatgccg      1020
     ctcgcgcgtg ccacgttggt ttttccggat tttccggtgt ggaacggcga accggtttcc      1080
     gggtctagtt tcctgctcgt cggcgagcaa ggacgtggtg acgaaatcca gttcatccgg      1140
     tttgccgagt ggctgcatca gcaaggcgca gttgtcgatg tactggtcag ccaacccgtc      1200
     gccagaattg cggccagcat gaccggcgta cgatcggtgt ttacaaaatt accggccggt      1260
     ccttacgact actggagcca tatgctaagg atgccggagc atatgaagct cgacctgcca      1320
     atgctccctg ttgccatgcc atacatctcg gcatcgccgc ttcatgttga ccaatggcgg      1380
     tcaaggatca atgcagcttc accgtcaact gcgtataaga aaaccgcgag aatcggcgta      1440
     gtgtgggcag gcggcgccca cactgctctg gatcgattcc ggtcgattag tatggaagcg      1500
     ctgaaacctc tattggagca tccggggacg acatggtttt cattacagaa aggcgagcat      1560
     gaacgcgaca gcgaacgtct ggcgggcaag ttcgatttgc acacgctcgg accagtcatc      1620
     gaagacttcg ccgatacgct cgccatactt gaaacgcttg acctgctcat caccgttgat      1680
     acggccgtcg cacatcttgc cggcgcggcg aaccttcctg tctgggtact cttgcccgcg      1740
     tattcggagt tgcgctggct gaccggcaga acagatagcc cctggtatcc atcaatgcgg      1800
     ctattccgcc agcgcgaact cggagagtgg aacaccgttg tcgaagaaat gagggaggct      1860
     ctgacggatt ggtgccgtac cggaccgata tag                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page