(data stored in ACNUC7421 zone)

EMBL: CP000271.PE408

CP000271.PE408       Location/Qualifiers
FT   CDS_pept        470345..472615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2617"
FT                   /product="Putative isoquinoline 1-oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2617"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33376"
FT                   /db_xref="GOA:Q13RB3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB3"
FT                   /protein_id="ABE33376.1"
FT                   /translation="MLKRRTFLLGGAGAVGALLVGWSVLPPGQRLTTSMPLPAQGTQVA
FT                   LNGWVKIAADNSVTIMMCKAEMGQGIHTGLAMLLAEELDADWSQVRVEDSPIDRIYNSV
FT                   QNIIDDLPFRPDDDSAIKRATVWMTRKVVSEAGTMMTGGSSSINDLWTPMREAGASARA
FT                   MLIGAAAAQWKVPAGECRAEGGHVLHPSGHKASFGELSSMAAQQPLPRQVALKDPAGFK
FT                   LIGKPLRRIEAASKINGTARFGIDALPDGLLYASVVMCPTLGGSVARFDATAAGKMPGF
FT                   IKAFAVAPYNGGTGGVAVIADNPFRAMNAVTAVEVDWHDGPAAKLSNADVDRHLAQALD
FT                   DGDGHAYYRLGDVDAALSRAARTVSAEYRAPYLAHGAVEPPNCTVQVTDGSAAVWVSTQ
FT                   MPALARHHVAKVLDLDADKVDVQTLLLGGAFGRRLELDFIAQAAAIAREGGGRPVQTIW
FT                   SRAQDFTHDFYRPACVSRLKAGFDNDGKLVAWQATSASQAIVPESLARYYGVPRIPIDK
FT                   TTCEGAFDQPYEWPAARVAHKIVELPVPVGFWRSVGHSHQAFFTEGFTDELAVAAGQDP
FT                   IAFRAALLAQHPRHLAVLRRVAVLSDWGHPLTHAADGAPRARGVALHEAFGSVVAQVAE
FT                   VSIGPDKGIRVHRVVCVIDCGMPVNPNLIRQQMESAIVFGLSTALQDEISLVNGQVQQK
FT                   NFVDFPVVRINDCPVIDTDIMPSQMHPQGVGEPGVPPVAPAVANAVFALTGQRLRSLPL
FT                   KLA"
     atgttaaagc gcagaacctt cctgctcggc ggcgccggcg ctgtcggcgc gctgctggtc        60
     gggtggtcgg tgctgccgcc tgggcagcgt ttgaccacgt ccatgccgct gccggcgcaa       120
     ggcacacagg tggcgctcaa cggctgggtc aagatcgccg ccgacaacag cgtgacgatc       180
     atgatgtgca aggcggaaat gggccagggc atccacacgg gcctcgccat gctgctcgcc       240
     gaagaactcg acgccgactg gtcgcaagtg cgggtcgaag actcgcccat cgacaggatc       300
     tacaacagcg tgcagaacat catcgacgac ctgccgtttc gccccgacga cgacagcgcc       360
     atcaagcgcg ccaccgtctg gatgacccgc aaggtggtga gcgaagccgg cacgatgatg       420
     acgggcggct catcgagcat caacgatctc tggacgccga tgcgcgaagc cggcgcttcc       480
     gcccgcgcca tgctgatcgg cgcggcggcc gcgcaatgga aagtgccggc cggtgaatgc       540
     cgcgcggaag gcggccacgt gctgcacccg tcgggacaca aggcaagctt cggcgaattg       600
     tcgtcgatgg ccgctcagca accgctgccg cgccaggtgg cgttgaaaga tcccgccggc       660
     ttcaagctga tcggcaaacc gctacgccgt atcgaagcgg cgtcgaagat caacggcacg       720
     gcgcgcttcg gtatcgacgc gcttcccgac ggcctgctct atgcgagcgt cgtcatgtgc       780
     ccgacgctgg gcggttcggt cgccaggttc gatgcaacgg ccgccgggaa aatgccgggc       840
     ttcatcaagg ccttcgccgt cgcgccgtat aacggcggca cgggtggcgt cgcggtgatc       900
     gcggacaacc cgtttcgcgc gatgaacgcg gtcaccgccg tggaggtgga ctggcatgac       960
     ggcccggcgg cgaagctgtc gaacgcggac gtggaccgcc atctcgcgca agcactggac      1020
     gatggcgacg gccacgccta ctaccgtctg ggcgacgtag acgccgcgtt gagccgcgcg      1080
     gcgcgtaccg tcagcgcgga atatcgcgcg ccgtatctcg cgcacggcgc ggtcgagccg      1140
     cccaactgca ccgtacaggt cacggacggc tcggccgcgg tctgggtttc cacgcaaatg      1200
     cccgcgctcg cgcggcatca cgtggcgaag gtgctggatc tcgacgccga caaggttgac      1260
     gtgcaaacgc ttctgttagg cggcgcgttc gggcggcgcc tggaactcga tttcatcgcc      1320
     caggccgcgg cgattgcgcg cgagggcggc ggccgtccgg tgcaaaccat ctggtcgcgg      1380
     gcccaggact ttactcacga tttctatcgt cccgcgtgcg tgtcgcggct gaaggccggt      1440
     ttcgacaacg acggcaaact ggtggcgtgg caggccacgt cggccagtca ggcgatcgtg      1500
     ccggaatctc tcgcgcgcta ttacggcgtg ccgcgcattc cgatcgacaa gaccacctgc      1560
     gaaggcgcct tcgatcagcc ctacgaatgg cccgccgcgc gcgtggcgca caagattgtc      1620
     gaattgccgg tgccggtcgg cttctggcgc tcggtgggtc attcgcatca ggcgtttttc      1680
     accgagggtt tcaccgacga actcgccgtg gccgccggcc aggatccgat tgcgtttcgc      1740
     gccgcgctgc tcgcgcagca tccgcgacat ctggcggtgt taaggcgggt tgcggttttg      1800
     tcggactggg ggcatccgtt gacgcatgcc gccgacggcg cgccgcgcgc gcgtggcgtt      1860
     gcgttgcacg aggcgttcgg cagcgtggtc gcgcaggtgg cggaggtgtc gatcgggccg      1920
     gataagggga ttcgcgtgca tcgggtggtc tgcgtgatcg attgcggcat gccggtcaat      1980
     ccgaatctga tccgtcagca gatggaaagc gcgatcgtgt tcggtctctc caccgcgttg      2040
     caggacgaaa tctccctcgt caacggtcag gtgcagcaaa agaactttgt ggatttcccg      2100
     gtcgtgcgga tcaacgattg cccggtgatc gacacggaca tcatgccgag ccagatgcat      2160
     ccgcaaggcg tgggcgagcc gggcgtgccg ccggtcgcgc cggcggtggc gaatgccgtg      2220
     ttcgcgttga cgggccagcg cttgcgctca ctgccgttga agctcgcgtg a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page