(data stored in ACNUC7421 zone)

EMBL: CP000271.PE409

CP000271.PE409       Location/Qualifiers
FT   CDS_pept        472667..473128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2616"
FT                   /product="Putative isoquinoline 1-oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2616"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33377"
FT                   /db_xref="GOA:Q13RB2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB2"
FT                   /protein_id="ABE33377.1"
FT                   /translation="MGSLNINGRAVAVQADPDMPLLWVLRCELGMTGTKFGCGLGICGA
FT                   CMIHVDGEASFACQTLMSSLHTQKITTIEGLQGAEAQALKAAWIDLDVVQCGYCQSAQL
FT                   MAACALLKHNPKPTDADIDTAMCHIVCRCGTYPRVRAAIHQAAAKRRSA"
     atgggatcac tgaacatcaa cggccgcgcg gtggcggtgc aagccgaccc ggatatgccg        60
     cttctgtggg tgctgcgttg tgaactcggc atgacgggca ccaagttcgg ctgcgggctg       120
     gggatttgtg gcgcgtgcat gattcatgtg gacggcgaag cgagcttcgc gtgccagacg       180
     ctcatgtcga gtctgcatac acagaagatt acgactatcg aaggcttgca gggcgccgaa       240
     gcacaggcac tgaaggcggc gtggatcgat ctcgacgtgg tgcagtgcgg ctattgccag       300
     agcgcgcaac tcatggcggc ctgtgcgctg ctcaagcaca atcccaaacc caccgacgcc       360
     gacatcgaca cggcaatgtg tcatatcgtg tgccgttgcg gcacctatcc acgggtccgg       420
     gcggcgattc atcaggcggc ggcaaagcgt cggtcagcgt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page