(data stored in ACNUC7421 zone)

EMBL: CP000271.PE411

CP000271.PE411       Location/Qualifiers
FT   CDS_pept        complement(475033..476037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2614"
FT                   /product="aromatic acid efflux pump, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2614"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33379"
FT                   /db_xref="GOA:Q13RB0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RB0"
FT                   /protein_id="ABE33379.1"
FT                   /translation="MKKTWFSVGQILLTLIVVVAAALVLWKLVDYYMFAPWTRDGHVRA
FT                   DVIQVAPDISGLISSVEVVDNQQVRQGQVLFVIDQARYTLALRQAQATAQQRRATLDQA
FT                   RREDARNRKLGNLVAAEVSEESRSRVEQGEAALADANVAIDTAKLNLQRATIVSPVDGY
FT                   LNDRAPRAGEFVAAGRAVVSVVDMHSFRVDGYFEETKLRGIGIGQPVDIKVMGEPDVLR
FT                   GHVQSIVAGIEDRDRSQGTNLLPNVNPAFSWVRLAQRIPVRVALDEVPADFRMIAGRTA
FT                   TVSVRDLAPGGKTRPGADAVGAVGAVGASASSSTLATSTVPAASAAVISGASQ"
     gtgaaaaaaa cctggttctc cgtcgggcag attctgctca ccctgatcgt cgtcgtggcc        60
     gcggctctgg tgctgtggaa actggtcgac tactacatgt tcgccccgtg gactcgcgac       120
     ggacacgtac gcgccgacgt gatccaggtg gcgccggaca tctcggggct gatctcgtcg       180
     gtcgaagtgg tggacaacca gcaggtcagg caaggccagg tgctgttcgt gatcgatcag       240
     gcgcgctata cgctcgcgct gcgccaggcg caggccaccg cgcaacaacg ccgcgccacg       300
     ctcgatcagg cgcgccgcga agacgcgcgc aatcgcaagc tcggcaacct ggtggcggcg       360
     gaggtgtccg aagaaagccg ctcgcgcgtc gaacagggcg aagccgcgct tgctgatgca       420
     aacgttgcga tcgataccgc gaagctgaat ctgcaacgcg ccacgatcgt gagtccggtc       480
     gacggttatc tgaacgaccg cgcgccgcgc gccggcgaat tcgtcgcggc ggggcgggcg       540
     gtggtctcgg tggtggacat gcattcgttc cgcgtcgacg gttatttcga ggagaccaag       600
     ctgcgcggca tcggcatcgg ccaaccggtg gatatcaagg tgatgggcga gccggacgtg       660
     ctgcgcggac acgtgcagag cattgtcgcc ggtatcgagg atcgcgaccg ctcgcagggc       720
     acgaatctgc tgccaaacgt gaacccggcg ttcagctggg tgcggctcgc gcaacggatt       780
     ccggtgcgcg tggcgctcga cgaagtgccc gccgatttcc gcatgatcgc gggacgcacc       840
     gcgacggtgt cggtgcgcga tcttgcgccg gggggtaaga cgcggccggg tgcggatgcg       900
     gtgggtgcgg tgggtgcggt gggtgcgtcc gcttcttctt cgaccttggc tacgtccact       960
     gttccggctg cttcggccgc ggtgatctcg ggcgcgtcgc aatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page