(data stored in ACNUC7421 zone)

EMBL: CP000271.PE412

CP000271.PE412       Location/Qualifiers
FT   CDS_pept        complement(476034..476243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2613"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2613"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33380"
FT                   /db_xref="GOA:Q13RA9"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA9"
FT                   /protein_id="ABE33380.1"
FT                   /translation="MIGEIDIFGVFVPAVLVLMLIAYLVNLAIRTVLARVGFYRFVWHR
FT                   SIFDLGIYVLVLGLVVVVSHRLIT"
     atgatcggtg aaatcgatat cttcggcgtg ttcgtgccgg ccgtgctcgt gctgatgttg        60
     atcgcgtatc tggtcaacct ggcgatccgc acggtgcttg cgcgcgtcgg cttttaccgc       120
     ttcgtctggc atcgctccat cttcgatctc ggcatctatg tgctggtgct gggccttgtc       180
     gttgtcgttt cgcacagact aataacgtga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page