(data stored in ACNUC7421 zone)

EMBL: CP000271.PE415

CP000271.PE415       Location/Qualifiers
FT   CDS_pept        complement(479102..480760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2610"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2610"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33383"
FT                   /db_xref="GOA:Q13RA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA6"
FT                   /protein_id="ABE33383.1"
FT                   /translation="MEQRVLILAPFGRDADVIAEVLRKDDRMCVACHDADALTTALDAG
FT                   AGAALIAEEALAGDHAMRLFNWLEQQPAWSDFPFTLLAAPRVGHRSERGLEVLERLGNV
FT                   VVLERPLNSETLRRAVASSLRARARQYETRRHLAERIQAQDALVQLNDSLESRIAERTH
FT                   ELASANNRLMMEIHERAKVQAVLVQSQKMEALGQLTGGIAHDFNNLLNVIMVNAELIAR
FT                   VSSDERLRGMAATVKRATERGAKLTGQLLTFSRNSNLDLKAVDVVTLLQGMRDIITVSL
FT                   GSSIRYTNEFDGAELWTEADANQLELAILNLAINARDAMPAGGQLGIRVKEREAPDQTL
FT                   EAGPYVVIEVADTGSGVPPEVVSRVFDPFFTTKPIGKGTGLGLSQVYGIATQAGGTARL
FT                   FSEEGVGTTVEIWLPLRERVVPQAEATSNAEANAVGEKRVLVVEDDGEVRAMLVESLRM
FT                   LGYTVTEAADGRAGLNRLQDDKPDLLMVDFAMPGMNGIDVIAEARKLREDLPVILATGY
FT                   ADVDISGLAVKRCTILRKPFQLDDLARTVRLGLAA"
     atggaacaac gcgttcttat cctcgcgccg tttggccgcg acgccgatgt gatcgcagaa        60
     gtactgcgca aagacgaccg catgtgcgtg gcatgccacg atgccgacgc gctcaccacc       120
     gcgctggatg ccggcgccgg cgccgcgctg attgccgaag aagcgctggc gggcgaccat       180
     gcaatgcgcc tgttcaactg gctcgaacag cagccggcat ggtccgactt cccgttcacg       240
     ctgctcgccg cgccgcgcgt cggacatcgc tcggagcgcg ggctggaagt gctcgagcgg       300
     ctcggcaacg tggtcgtact cgaacgtccg ctgaattcgg aaacgctgcg gcgcgcggtg       360
     gcgtcgtcat tacgggcacg ggcgcgccaa tacgagacgc gccgccatct cgccgaacgg       420
     atccaggcgc aggatgcgct ggtgcaattg aacgactcgc tggagagccg cattgcagag       480
     cgcacccacg agcttgcttc cgccaacaac cggctgatga tggagattca cgagcgcgcc       540
     aaagtgcagg ccgtgctggt gcaatcgcag aaaatggaag cgctcgggca actcaccggc       600
     ggcatcgcgc acgacttcaa caatctgctg aacgtcatca tggtcaacgc ggagctgatc       660
     gctcgcgtga gcagcgacga gcgccttcgc ggcatggccg ccaccgtcaa acgcgcgacc       720
     gaacgcggcg cgaaactgac aggacagttg ctcactttct cgcgcaacag caacctcgac       780
     ctgaaagcgg tcgacgtggt gacgttgctg caaggcatgc gcgacatcat cacggtatcg       840
     ctcggttcga gcattcgcta caccaacgag ttcgacggcg cggagctgtg gaccgaagcc       900
     gacgccaatc agctcgaact ggccatcctc aatctcgcca tcaacgcgcg cgacgccatg       960
     ccggccggcg gccagctcgg gattcgcgtg aaagagcgcg aagcgccgga tcagacgctc      1020
     gaagccggcc cctatgtggt gatcgaagtc gccgataccg gttcgggcgt gccgcccgaa      1080
     gtcgtgtcgc gcgtgttcga tccgttcttc accaccaagc cgatcggcaa gggaaccgga      1140
     ctcggcctga gccaggtcta cgggatcgcg acgcaggccg gcggcaccgc gcgtctcttc      1200
     agcgaggaag gcgtgggcac caccgtcgag atctggctac cgttgcgcga acgcgtggtg      1260
     ccgcaagccg aagcgacgtc gaatgcggaa gcgaacgcgg tcggcgaaaa acgcgtgctg      1320
     gtggtcgaag acgacggcga ggtgcgcgcc atgctcgtcg agtcgctaag aatgctcggc      1380
     tacaccgtga ccgaagccgc cgacggacgc gccggactga accgtttgca ggacgacaaa      1440
     ccggacctgc tgatggtgga cttcgccatg cccggcatga acgggatcga cgtgatcgcg      1500
     gaggcgcgca aactgcgcga ggatctaccg gtgatcctcg caaccggcta tgcggacgtg      1560
     gatatttccg gactggcggt gaagcgctgc acgatcctgc gcaaaccgtt tcagctcgat      1620
     gacctggcac gtacggtgag gcttgggctc gcagcgtga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page