(data stored in ACNUC7421 zone)

EMBL: CP000271.PE416

CP000271.PE416       Location/Qualifiers
FT   CDS_pept        complement(480765..482282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2609"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Weak similarity to circadian clock proteins
FT                   ofCyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33384"
FT                   /db_xref="GOA:Q13RA5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA5"
FT                   /protein_id="ABE33384.1"
FT                   /translation="MSNRHDADTPARLSSGIDGIDDILGGGLTPHRMYLVEGAPGTGKT
FT                   TLALQFLLKGVEEGQGGLYITLSETRPELIAVAESHGWDISRFTILELLSDEGLDPQYE
FT                   QTVLHPAEVELGETVRNVIQHVDELKPARIVLDSLSELRLLSQNPLRYRRQILALKRYF
FT                   ATRECTVLLLDDNSSDPGDVQLHSIAHGVISLDNLVHDYGGNRRRARVAKMRGIKFREG
FT                   YHDFTLDTGGIHVYPRLVAAEHHADFSTEVVSTGTAGLDALLGGGLIPGTNALMIGPSG
FT                   VGKTTTVVSCLIAALERGERCVYYVFDETLTTLMTRCATLGIYLAPHVESGLLTLRQID
FT                   PAEISPGEFASDVRRSVEKKGVRYVAIDSLNAYLQAMPGERYLLLQMHELLGYLNQQGI
FT                   VTMLVLGQHGIIGEVQNDIDISYLSDVVVLFRYFEHHGEVLTAITAVKSRANAHERSIR
FT                   QFRLGVNGVEVGDALRDFEGVLSGLPAYRGSTALLGATNRVIETPGK"
     atgtcaaacc gacacgacgc cgacacaccg gcccgcctgt cctcaggaat cgatggaatc        60
     gacgacatcc tgggaggcgg tctcacaccg caccgcatgt acctcgtgga aggagcgccc       120
     ggtacaggta aaactaccct ggccttgcag ttcttactca agggtgtcga agaaggccag       180
     ggcggcttgt atatcacgct gtccgaaacc cgcccggagt tgatcgcggt ggccgaaagt       240
     catggctggg acatcagccg gttcacgatt ctggaactgc tttccgacga aggcctcgac       300
     ccgcaatacg agcagaccgt gctgcacccg gccgaagtcg aactcggcga gaccgtgcgt       360
     aacgtgatcc agcatgtcga cgaactcaaa cccgctcgca tcgtgctcga cagcctctcc       420
     gaactgaggc tgctgtcgca gaacccgctg cgctaccggc ggcagattct cgcgctcaag       480
     cgttatttcg ccacccgcga atgcaccgtg ctgctgctcg acgacaattc gtccgacccc       540
     ggcgacgtgc agctgcacag catcgcgcac ggcgtgatca gcctcgacaa cctcgtgcac       600
     gactatggcg gcaaccgccg ccgcgcacgc gtcgccaaga tgcgcggcat caagttccgc       660
     gagggctacc acgacttcac gctcgacacc ggcggcatcc atgtctatcc gcgtctcgtt       720
     gcggccgagc atcacgcgga cttcagcacc gaggtggtga gcaccggcac ggcgggactc       780
     gacgcgctgc tcggcggcgg cctgatcccc ggcaccaacg cgctgatgat cggcccctcg       840
     ggtgtgggca agaccaccac ggtggtgtcg tgcctgatcg cggcgctgga acgcggcgag       900
     cgttgtgtct actacgtgtt cgacgaaacc ctcaccaccc tgatgacccg ctgtgcgacg       960
     ctcggcatat atctcgcgcc gcacgtcgag agcggcttgc tgacgctgcg ccagatcgat      1020
     ccggcggaaa tctcgccggg cgagttcgcg agcgacgtgc gccgttcggt cgaaaagaag      1080
     ggcgtcaggt acgtcgcaat cgacagtctg aacgcttacc tccaggccat gcccggcgag      1140
     cgctatctgc tgctgcaaat gcacgaactg ctcggctatc tcaaccagca aggcatcgtc      1200
     acgatgctcg tgctggggca gcacggcatt atcggcgagg tgcagaacga tatcgacatc      1260
     agctatctga gcgacgtggt cgtgctgttc cgctatttcg aacaccacgg cgaagtgctc      1320
     accgccatca ccgccgtgaa gagccgggcc aacgcccacg aacgctcgat acggcagttc      1380
     cgtctcggcg tgaacggcgt tgaggtgggc gacgcgctgc gcgacttcga aggcgtactc      1440
     tccggactgc cggcttatcg tggcagcact gccctgctgg gggcgacgaa ccgcgtcatc      1500
     gaaacgcccg ggaagtga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page