(data stored in ACNUC7421 zone)

EMBL: CP000271.PE419

CP000271.PE419       Location/Qualifiers
FT   CDS_pept        484588..485664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2606"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2606"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33387"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA2"
FT                   /protein_id="ABE33387.1"
FT                   /translation="MTFNLSRRLAVLCAATGAALLMTLAQPAFAVHAYEPHLKPVATVS
FT                   DTRFTLDTPQGHAEFPLYLSKDWSVAQPQVTRAVIVIHGKLRNADVYFRTAQKARDAAH
FT                   ADPDATLLIAPQFLATLDTRVHDEPADLLRWSGDAWMGGDAAQAPLPISSYEVLDAIVA
FT                   RLADRKLFPNLRHVVFAGHSGGGQVVQRYAVAGRNIAALTDEGIDVRYVVASPSTYAYF
FT                   DAQRPNAQGVAAPFDAAQCPDFNQWKYGMDNRPPYLGDRTPAQLEATYAARRIDYLVGG
FT                   ADDDPQQNALDKTCAAEAQGPQRVARAEAYYRYIQSRHPHGLKQRFHIVPGVGHNGSRM
FT                   LTSVCALAAMFDTQGCEQ"
     atgactttca acctttcgcg acgtctcgcc gtgctgtgcg ccgcaactgg cgctgcactg        60
     ctcatgacgc tcgcgcaacc cgcgttcgcc gtccacgctt acgagccgca tctgaagccg       120
     gtggcgacgg tttcggatac gcgcttcacg ctcgacacgc cgcaagggca cgccgagttt       180
     ccgctgtatc tgtcgaagga ctggagcgtc gcgcagccgc aggtgacgcg tgcggtgatc       240
     gtgattcacg gcaaactgcg caatgcggac gtgtactttc gcaccgcgca aaaggctcgc       300
     gacgcggccc acgcggaccc cgacgccacg ttgttgatcg cgccgcagtt cctcgcgacg       360
     ctcgacacgc gcgtgcacga cgaacccgcc gatctgctgc gctggagcgg cgacgcgtgg       420
     atgggcggcg acgcggcgca ggcgccgttg ccgatcagtt catacgaagt gctggacgcg       480
     atcgtcgcgc gtcttgccga tcgcaagctg tttccgaatc tccggcacgt cgtgttcgcc       540
     gggcattcgg gcggtgggca agtcgtgcag cgctacgcgg tggcggggcg caacattgcc       600
     gcgctgaccg acgagggcat cgacgtgcgt tacgtggtgg caagtccgtc cacctatgcg       660
     tatttcgatg cgcaacggcc caacgcgcag ggcgttgcag cgccgttcga tgccgcgcaa       720
     tgtcccgact tcaatcaatg gaaatacggc atggacaacc ggccgcctta tctcggcgac       780
     cgcacgcccg cgcaactgga ggcgacctat gcggcacgcc ggatcgacta cctcgtgggc       840
     ggcgcggacg acgatccgca acagaacgcg ctcgacaaaa cctgcgcggc cgaagcgcaa       900
     gggccgcaac gcgtcgcgcg tgccgaggcg tactaccggt atatccagtc gcgtcatccg       960
     cacggtctga agcagcgctt tcatatcgtg ccgggcgtgg ggcacaacgg ctcgcgcatg      1020
     ttgacgtcgg tatgcgcgct ggcggcgatg ttcgacactc agggatgcga acaatga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page