(data stored in SCRATCH zone)

EMBL: CP000271.PE42

CP000271.PE42        Location/Qualifiers
FT   CDS_pept        complement(44361..45353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2986"
FT                   /product="putative DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2986"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33010"
FT                   /db_xref="GOA:Q13SC9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC9"
FT                   /protein_id="ABE33010.1"
FT                   /translation="MLHDLVEQYGPALVFVNVLAASIGLPVPALPSLVLFGAMAAMHPG
FT                   SVGTQLAPVLVLSIFATLIGDSAWYFAGRMYGGNTLKAICRLSLSRDTCVKKTERFFGR
FT                   WGVRVLAVAKFVPGLSIVSIPMAGAMGTRYRTFLTYDSIGAALWSGTGLIIGALFAKQI
FT                   DMLFALAGRLGRTAALVAVALLLAYAAYRWIRRRQLIAKLASARIEVDELAALVKAGNT
FT                   PVLFDIRSHEKRKLDPFVIPGTQFADERQLDEIVATYPRDQKLVIYCSCPNEISAAWMA
FT                   RQLNEAGFSDVLPLRGGMEAWRDSGKPVESLPDMPPPEVAVEDVAPKAV"
     atgctacatg atctcgtcga gcaatatggg ccggcgctcg tcttcgtgaa cgtgctcgcg        60
     gcctcgatcg ggctgccggt tccggcgctg ccgtcgctcg tgctgttcgg ggcgatggcg       120
     gccatgcatc ccggttccgt gggcacgcaa ctggcgccgg tactcgtcct gtcgatcttc       180
     gccacgctga tcggcgacag cgcgtggtat ttcgccggcc gcatgtacgg cggcaatacg       240
     ctaaaagcga tttgccgcct gtcgctctcg cgcgacacct gtgtgaagaa gaccgaacgc       300
     tttttcggcc gctggggcgt gcgcgtgctg gcggtggcca agttcgtacc cggcctgtcg       360
     atcgtgtcga ttccaatggc cggtgcaatg ggcacgcgct accgcacgtt tctcacctac       420
     gacagcatcg gcgccgcgtt gtggtccggc acgggcctga tcatcggcgc gttgttcgcg       480
     aagcagatcg acatgctgtt cgctctcgcc ggtcgcctcg gccgcacagc cgcgctggtc       540
     gccgtcgcgc tgctgctggc gtatgcggcc tatcgctgga tacgccggcg ccagttgatc       600
     gcgaagctcg cgtccgcgcg catcgaagtc gacgaactgg ccgcgctggt caaggccggc       660
     aacacgccgg tgctgttcga tatccgctcg cacgaaaagc gcaagctcga tcccttcgtg       720
     attccgggca cgcaattcgc cgacgagcgg caactcgacg agatcgtcgc gacctatccg       780
     cgcgatcaga agctggtgat ctactgttcc tgcccgaatg agatttccgc ggcatggatg       840
     gccaggcaat tgaacgaagc cggtttttcc gacgtgctgc cgctgcgcgg cggcatggaa       900
     gcctggcgcg actcgggcaa gccggtggaa tcgctgcccg acatgccgcc gcccgaagtg       960
     gcggtcgaag acgtcgcgcc gaaggctgtg tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page