(data stored in ACNUC7421 zone)

EMBL: CP000271.PE421

CP000271.PE421       Location/Qualifiers
FT   CDS_pept        487039..488052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2604"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2604"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33389"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RA0"
FT                   /protein_id="ABE33389.1"
FT                   /translation="MTQPLITDDERAPNERPVAVVASRHLSVTTRAGSGTVPVFANGDW
FT                   LAPTREVRRAVILIHGRLRNGDTYYDLAERSCALAGGSAADTLLIVPQFLATADVEAHE
FT                   LPPSTLHWDWTSWMGGENAEGPAPISSFEVLDAILLTLASREQFASLAEVVIAGHSGGG
FT                   QVVQRYAVVAHSEAPLTARGVAVRYVVANPSSYVYFDAMRPVASGEFAAFDRAMCPSFN
FT                   RWKYGLEDLPAYASDPDSAACAAALEARYVQRDVTVLLGGEDCDPLHPALDRSCAAQSQ
FT                   GSHRLGRGLAYARYMAARHPEGLPTHRTFVVDGVGHDAKGIFSSAYGLAALFGAGL"
     atgacccagc ctttgatcac agacgacgaa cgcgcgccga atgaacgccc ggttgcggtc        60
     gtcgcgagcc ggcatctgag cgttacgacg cgagccggca gcggcacggt gcccgtattt       120
     gcgaacggcg actggctagc gccgacgcgt gaagtccgcc gcgccgtgat tctgattcac       180
     ggccgactgc gcaacggcga tacctattac gatctcgccg agcggtcgtg cgcgctcgcg       240
     ggcggcagcg cggccgatac gctgctgatc gtgccgcagt ttctcgcgac cgcggacgtc       300
     gaggcgcatg agctgccgcc gtccacgttg cattgggact ggacgagctg gatgggcggc       360
     gaaaacgccg aaggtcccgc gccgatcagt tcgttcgagg tgctcgacgc gattttgctc       420
     acgctcgctt cgcgtgagca gttcgcgtcg cttgccgagg tggtgatcgc cgggcactcc       480
     ggcggcggcc aggtcgtgca gcgctatgcg gtggtggcgc acagcgaggc gccgcttacg       540
     gcgcgtggtg ttgcggtgcg ctatgtggtc gcgaatcctt cgtcgtatgt gtacttcgat       600
     gcgatgcggc ccgtcgcgtc cggcgagttc gcggcgttcg atcgggcgat gtgtccgtcg       660
     ttcaatcgct ggaagtatgg gctcgaggat ttgccggctt acgcgagcga cccggatagc       720
     gcggcttgcg ctgcggcgct cgaagcgcgc tatgtgcagc gtgacgttac ggtgctgctc       780
     ggcggtgaag attgcgatcc gctgcatccc gcgctcgacc gttcttgtgc cgcgcaaagc       840
     caggggagtc accggctcgg gcgcggactg gcctatgcgc gctatatggc ggcgcggcat       900
     ccagaaggat tgccgacgca ccggacgttt gtggtcgatg gggtggggca tgatgccaag       960
     gggattttct cgtcggctta tgggttggct gccttgttcg gcgccggcct gtga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page