(data stored in ACNUC7421 zone)

EMBL: CP000271.PE422

CP000271.PE422       Location/Qualifiers
FT   CDS_pept        488066..488614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2603"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R99"
FT                   /protein_id="ABE33390.1"
FT                   /translation="MVHGVMHSAHIGTKRAAALDACLMLPVCHFEDRADMNRIRLVATV
FT                   LAAASLGALLPCSGAYADDAPSPCTSLKRIVAAAPGGLASLTPDDGKGIAQPYGDDAQC
FT                   SASHGSYQCTWTPHHDAGSNADALQAVAADVASCLPDATHDQNSPGRQHFYLGAKGKRT
FT                   GITLTPTGANKLRLVVSGK"
     gtggttcatg gagttatgca ctcggcgcac ataggcacga agcgtgctgc tgcgcttgat        60
     gcctgtttga tgctacctgt gtgtcacttc gaggaccgcg ccgatatgaa cagaatccga       120
     ctggttgcta ccgtacttgc cgctgcgtcg ctaggcgcct tgctgccgtg cagcggcgcg       180
     tatgccgacg atgcgcccag cccatgtaca tcgctgaaac ggatcgtggc ggccgcgccg       240
     ggcggcctcg cctcgttgac gccggacgac ggtaaaggca tcgcgcaacc ctatggcgac       300
     gacgcgcaat gttcggcaag ccacggcagc tatcaatgca cgtggacgcc gcatcacgac       360
     gccggttcga acgcggacgc gctgcaagct gtcgcggcgg acgtcgcgtc gtgtctgccc       420
     gacgcgacgc acgatcagaa ttcgccggga cgtcagcatt tttatctggg cgcgaagggc       480
     aaacgcaccg gcattacgct gacaccgacg ggtgcgaaca agctgcgtct ggtggtgtcg       540
     ggcaagtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page