(data stored in ACNUC7421 zone)

EMBL: CP000271.PE424

CP000271.PE424       Location/Qualifiers
FT   CDS_pept        489497..489730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2601"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2601"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33392"
FT                   /db_xref="GOA:Q13R97"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R97"
FT                   /protein_id="ABE33392.1"
FT                   /translation="MTEAVFNSASRPASQPVAQPTPIPLRELLPWLVFGGLLLLLALYF
FT                   VGAEQGATSLVPGMYVHEFVHDGRHLLGFPCH"
     atgactgaag ccgttttcaa ttccgcttcc cggcctgctt cccaacccgt tgctcaaccc        60
     acgccgattc cgctgcgcga gttgttgccg tggctcgtgt tcggcggttt gctgctgttg       120
     cttgcgcttt acttcgtggg tgcggaacag ggcgccacat cgctcgtgcc gggtatgtac       180
     gtgcatgagt tcgtgcacga cggccgccat ctgctcggct ttccctgcca ctaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page