(data stored in ACNUC7421 zone)

EMBL: CP000271.PE425

CP000271.PE425       Location/Qualifiers
FT   CDS_pept        489742..490482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2600"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2600"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33393"
FT                   /db_xref="GOA:Q13R96"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R96"
FT                   /protein_id="ABE33393.1"
FT                   /translation="MVGKLLVRGMLAGIAAGLLTFGFARVVGEPQVNQAISFEEKADAA
FT                   KGEAPEPELVSRDTQRGLGLLTGVVVYGAAFGGLFSLVFAYAYGRVGALSARALSAWLA
FT                   LGAFIALAVVPNLKYPANPPSVGDPDTIGMRTGLFFLMIAISLAAMVFSLKVRRRAAAK
FT                   LGAWNGSIVAGLVFVVIIAAVQLSMPAINEVPEAFPAVLLWKFRVAALGMQAIMWTTIG
FT                   LLFGALVERGAFMRVGGGSAVESA"
     atggtcggta aattgttggt acgcgggatg ctcgcaggca tcgccgcggg actgctcacg        60
     ttcggcttcg cccgcgtggt gggcgagccg caagtcaatc aggcgatttc attcgaagaa       120
     aaggccgatg ccgcgaaagg cgaggcgccc gaacctgaac tggtgagccg cgatacacag       180
     cgcggacttg gcttgttgac cggtgtggtg gtttacggtg cggcattcgg cggcttgttc       240
     tcgctggtgt tcgcttacgc gtatgggcgg gttggggcat tgagcgcgcg cgcgttgtcc       300
     gcgtggctgg cgctcggcgc gttcattgcg ctggcggtcg ttccgaacct gaagtatccg       360
     gcgaacccgc cttcggtcgg cgacccggac acaatcggaa tgcgcacggg gttgttcttc       420
     ctgatgattg cgatctcgct cgccgcgatg gtgttttcgc tcaaggtccg acgccgtgcg       480
     gccgcgaaac tcggcgcgtg gaatggctcg attgtggcgg ggttggtctt cgtcgtgatt       540
     atcgccgcgg tgcagttgtc gatgccggct atcaacgaag tgccggaggc ttttccggcg       600
     gtgctgctgt ggaagttccg tgtggcggcg ctcggtatgc aggcgatcat gtggacgacg       660
     attggactgc tgttcggcgc gcttgtcgag cggggtgcgt ttatgcgggt gggcggaggg       720
     tcggcggtgg agtcagcctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page