(data stored in ACNUC7421 zone)

EMBL: CP000271.PE426

CP000271.PE426       Location/Qualifiers
FT   CDS_pept        491039..491179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2599"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33394"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R95"
FT                   /protein_id="ABE33394.1"
FT                   /translation="MSHVMEGQDTTRWKYFFDTLRIAETPATLTLEAVRTGIGWERKEK
FT                   S"
     gtgtcgcacg tgatggaagg ccaggacacg acgcgctgga aatacttctt cgatacgctg        60
     cgcatcgcgg aaacgcctgc gacgctcacg cttgaggcgg tgcggacagg tatcgggtgg       120
     gaacggaagg aaaaatcata g                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page