(data stored in ACNUC7421 zone)

EMBL: CP000271.PE427

CP000271.PE427       Location/Qualifiers
FT   CDS_pept        491547..493955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2598"
FT                   /product="YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33395"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R94"
FT                   /protein_id="ABE33395.1"
FT                   /translation="MCAPNVSNNKPIGIRTKKSRLHGETAGFAGRLLAAFSLLIFAFSA
FT                   NAVDCFSLYAQSGATPGSKTCKLDVTSNTPGGMGNYACINDLALIDQWCNSTETPPDDT
FT                   CPVADPVFPANGIVTFSETDFASGDASPLVFSRTYLSKPFDKAQVAMGGYWASNWQRRL
FT                   DLTSVNASTPKITAYRSNGQPLIFKWVNGGWAVPGTSGLSLLKAGDGYFYLKDERLGTT
FT                   ETYSVSTGLFHSETTRTGMYREVEYVGQQIDSIAQWPVDRTGQAASRLTLSLTYDSNGR
FT                   ILSVVPPSGNATHYAYDAKGNLVSVTAPIGYVRQYLYEDARFPNAMTGIKDESGSRIAT
FT                   WTYDSSGRAISVTHPDTTRNVSFSYGANTTTVSNMSGNSTYSFNVGDTSRPGSIVTPGG
FT                   AVSRTWDTSGNLNQTITPDGNTQYTWDGANRPTKAVATVSGNRTVTTIEYSDSTSLRPH
FT                   LVATPGKIRAFVYDQAGNVTGYAETETSDLTGDQGMQAVGTGNQWTVGARYDSASRLLS
FT                   AAITRNGSKREDWTYTYDVRGNVESVQDAVSGWSMRTLSRNAENRATQIAGNSGQASIG
FT                   YDERGRVKSFQYSEPASSLNGGLARVLAVDYRYGPDGSVSSRTAQVSTNGAWWKPISDA
FT                   ELGVWLTNWELGNDPVAPPANLTGLQSDAPAFVPDMCVECYMAWKALPTGKLFGHELGE
FT                   TLPAWREATELMVSDQAQVPYPVLVPDLTSSAKRSTLYSTLFGGGSGDGGMVKCGGSGN
FT                   NEWREADCHAKYMYDMQICNSLGTIMGKSRGRALCKQQAFEDYQECRGH"
     gtgtgtgcac caaacgtttc aaacaataag ccaataggga taagaacgaa aaaatccaga        60
     ctccacggtg agacagccgg attcgcgggg cgcctgctgg ctgccttctc gttgctaata       120
     ttcgcgttca gcgctaacgc agtcgactgt ttttcgctgt atgcccagtc cggcgccacg       180
     ccgggctcca agacctgcaa gctcgacgtt acgagcaaca cgccgggcgg aatgggcaac       240
     tacgcgtgta tcaatgacct cgccctgatc gatcagtggt gcaattcaac ggaaaccccg       300
     ccagacgata cctgccccgt ggcagacccg gtgtttcccg cgaatgggat tgtgactttc       360
     tctgaaactg actttgcaag cggtgacgcg tcgccgcttg tgtttagtcg tacctacctt       420
     tcgaagccgt tcgacaaagc gcaggtagcg atgggcgggt actgggcaag taactggcag       480
     cgacggcttg atctgacctc ggtcaatgca agcacgccga aaatcaccgc gtatcggagt       540
     aacggccagc ctctgatctt caagtgggtt aacggcgggt gggcggtgcc gggtacgtcg       600
     ggtctttctc tcttgaaagc tggcgacgga tacttctacc tgaaggacga acggcttggc       660
     acgaccgaaa catactccgt cagcacaggt ctgtttcact ccgagacaac acgcacgggt       720
     atgtatcgtg aagttgaata cgttggacaa cagatagatt cgatcgcgca gtggcccgtt       780
     gatcggaccg ggcaggcggc atcgcggctg acacttagtc tgacatatga cagtaatggt       840
     cgcattctga gtgtagtgcc gccttcgggc aacgcgacac attatgcgta cgatgcgaaa       900
     ggcaatcttg tttcagtaac cgcgccgatt ggatacgttc gtcagtacct ttatgaggat       960
     gcccgcttcc ccaatgcgat gaccgggata aaggacgaat ccggttcacg gattgcaaca      1020
     tggacctacg attccagcgg acgcgcaatc tcagtcaccc atccggacac gacgcgtaac      1080
     gtttctttca gttatggcgc gaacacgacc actgttagca atatgtccgg caacagcacg      1140
     tattctttta atgttggaga cacgtcgcgt cctggctcaa ttgttacgcc tggcggcgcg      1200
     gtctcacgta catgggatac atcagggaac ctgaatcaga caattacacc ggatgggaat      1260
     acacagtaca cgtgggacgg cgccaaccgg ccgacgaaag cagttgcgac agtctctggc      1320
     aacaggacgg taacgacgat cgagtatagc gacagtacct cgttgcgtcc gcatctggtc      1380
     gccacgccgg gtaaaatccg cgcgtttgtc tatgaccagg ccggcaacgt tactggctac      1440
     gccgagacgg agacaagcga tctgacgggc gaccagggga tgcaagccgt tgggaccggt      1500
     aaccagtgga cagtcggtgc acgctacgat tcggcgagtc gccttctgtc ggctgcgatt      1560
     acccgtaatg gctcgaagcg tgaagactgg acctacacat acgatgtacg gggcaatgtc      1620
     gagtcagtgc aggatgccgt atctggctgg tcgatgcgaa cgctctcgcg caatgctgag      1680
     aatcgtgcaa cgcagatagc tggaaacagc ggtcaggcga gcatcgggta cgatgagcgc      1740
     ggtcgcgtaa agtcctttca gtatagcgaa ccggcaagtt cgttaaatgg tggacttgcc      1800
     cgtgtactgg cagtcgatta ccggtacggt ccagatggtt cggtgtcctc gcgcacggct      1860
     caggtttcaa cgaatggagc ctggtggaag ccgattagtg atgctgaact gggtgtctgg      1920
     ctgacgaact gggaactcgg gaacgacccg gttgcgccac ccgcgaacct gacaggactc      1980
     cagtcggatg ctccagcatt cgttcctgat atgtgcgtcg aatgctacat ggcctggaag      2040
     gcgttgccga caggtaagct atttgggcat gaactgggtg aaacgctacc ggcttggcgc      2100
     gaggcaaccg agttgatggt cagcgatcag gcgcaggttc cttatccggt gcttgtgccg      2160
     gatctgacga gttctgcgaa acggtcaacg ctttacagta cgctttttgg tggcgggagc      2220
     ggggatgggg gaatggtaaa gtgcggtggc agcgggaaca atgagtggcg cgaggcggat      2280
     tgtcatgcga agtatatgta cgatatgcaa atttgcaatt cgcttggcac cataatgggc      2340
     aagagccgag ggcgtgcgct ttgcaaacag caagcgttcg aggattatca agagtgtaga      2400
     ggtcattga                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page