(data stored in ACNUC7421 zone)

EMBL: CP000271.PE428

CP000271.PE428       Location/Qualifiers
FT   CDS_pept        493952..494230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2597"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33396"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R93"
FT                   /protein_id="ABE33396.1"
FT                   /translation="MMTSYPPRSVVVTYDEDSQQIVLQLVDPAKLAPLLARTLKAPILL
FT                   EEFDFRLDDEFVRRLGGGLLNLIALGQPEIKQYTTYTQHPIDELPEG"
     ttgatgacta gttacccccc gcgttcagtg gtcgtaacct acgacgaaga cagtcaacag        60
     atagttttgc agttagttga tccagccaag ctggcgccgc tcttggctcg aacgctgaaa       120
     gccccaattc tgctggaaga atttgatttc agacttgatg atgaatttgt acgtaggttg       180
     ggcggaggct tgcttaatct gattgctctt gggcagccgg agatcaagca atacacgacc       240
     tatacgcagc accccattga cgagctacct gaaggttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page