(data stored in ACNUC7421 zone)

EMBL: CP000271.PE430

CP000271.PE430       Location/Qualifiers
FT   CDS_pept        497330..500068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2595"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2595"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33398"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R91"
FT                   /protein_id="ABE33398.1"
FT                   /translation="MTWNTQSRTLEIVSDAIPEHCGKKIFEPVRCKGTDKLGRLFDYRI
FT                   DVQTIEANGLHVNDMDRLVDVSKLVGKRLTVKIAIEGSGTQESDEQNIGADVRVITGVI
FT                   AEVKCVGADDRRMFYRLRLRCLLWLASLNRDNRHFRDRTVREISDEILKKYPFSVRWNL
FT                   IGAGNGSRNFPKRDYQRQFWESDFSCLNRLWQEWGITFYWDDDTLVLMDNAGYPAHGPA
FT                   CKTVRYLERGGQRIDEEHIHKLEYSRGLTTGKVAGIDYDYTRATNRQFKRRISNHRDAA
FT                   HDNAEEYTWLDYAQPQQGAMGLNAEPNDYEFEGDHLARVRVDAHRNKSLVIKATGNLRG
FT                   VMTGHQLTVAGHPFAPVNRKYIVTGTKIEIVNNDSVTQGGTLQREYTCRTKFTAIPNDH
FT                   YYRTPQKAKKPRAFAEKAVVTGHDKKGVHTDAMARIRVKFIWDRVSQADEEASCWIPLM
FT                   QVWQGQRYGMNFVPRVGDHVYIGFLNMDPDRPFILGSHTTDRNEAPWDLYANHALSGWR
FT                   SQDLDGYGKGSNTVVTDDTPGQLQVQVTSDHANSRFVAGCNVRIDGNTGRSQARGEGIE
FT                   IATDANAVMRANRGMLITTEARDGATAPMKDMGETIARLDEARTLHDRLAGEAQANGAQ
FT                   DSGGDQKAVASAIRAQNRALAGKAGAGKFPEFAQPHVTLASPAGIESTTAGSTHVASGE
FT                   HLAMTSGADVAIAAGGSFFGTFGNKLRMTVQKAGMRLVAVSGDIDLRALKDSINLLARL
FT                   NVTVTAEKITISAKQEVEIRGGGSFTRWSNGKIYHGTPGQFEIHSAGRLFTGPDSASLP
FT                   TLPESAPGQQELHFALGALANGAAHRYVEEPYELYQGNALIDSGVTDSYGRVVVKDHQP
FT                   ETTEYCVKLCYGGQFRLKVKDALNADADHIDQRSNRGDRAV"
     gtgacatgga atacccagtc gcgcacgctg gaaatcgtca gcgacgcgat tccggagcac        60
     tgcgggaaga agatcttcga acctgtgcgt tgcaagggca cggacaagct gggccggctg       120
     ttcgactacc ggatcgacgt gcagaccatc gaggcgaatg gccttcacgt caacgacatg       180
     gacaggctgg tcgacgtcag caagctggtg ggcaaacgcc tgaccgtgaa aatcgccatt       240
     gaaggcagcg gcacgcagga gagcgacgag caaaatatcg gcgccgatgt tcgcgtaatc       300
     acgggtgtga ttgcggaggt gaagtgcgtg ggtgcggacg accggcgcat gttctaccgc       360
     ctgcgtctga gatgcctgct ctggctggcg tcgttgaatc gcgacaaccg gcatttccgt       420
     gacaggacgg taagggaaat ctccgacgag atcctgaaga agtatccgtt cagtgtccgg       480
     tggaacctca tcggtgcggg gaatggaagt cggaactttc cgaagcgcga ctatcagcgc       540
     cagttctggg agtcggactt ttcctgtttg aaccggcttt ggcaggagtg gggcatcacg       600
     ttctattggg atgacgacac cctggtgctg atggacaacg caggctaccc cgcgcacggt       660
     cctgcctgca aaacggtgcg ttacctcgaa cgcggcggcc agcgcattga cgaggagcat       720
     atccacaagc tcgagtattc gcgcgggctg accacgggca aggtggccgg gattgattac       780
     gactacacgc gcgcaacgaa ccggcagttc aaacgaagga tctcgaacca ccgggacgcc       840
     gcgcacgaca acgccgagga atatacctgg ctcgattacg cacagcccca gcagggtgcg       900
     atggggttga atgccgaacc gaacgactac gagttcgaag gcgatcatct tgcgcgcgtg       960
     cgcgtcgatg cacaccgcaa caagtcactg gtcatcaagg ccacgggaaa cctgcgcggc      1020
     gtgatgacgg ggcatcagct cacggttgcg ggtcatccgt ttgcacccgt caaccgcaag      1080
     tacatcgtca cgggcacgaa gatcgagatc gtgaacaacg attcggtcac gcagggcggg      1140
     acgctacagc gcgagtacac gtgcaggact aagttcacgg cgattccgaa cgaccactac      1200
     taccgcacgc cgcagaaggc gaagaaaccg cgcgcgtttg cggagaaagc ggtggtcacc      1260
     ggccacgaca aaaaaggcgt ccacacggat gcgatggcgc gtatccgcgt caaattcatc      1320
     tgggaccggg tgagccaggc cgatgaggaa gcgtcgtgct ggataccgct catgcaggtg      1380
     tggcaagggc agcgctacgg catgaacttc gttccgcgcg tgggcgatca cgtctatatc      1440
     gggtttctga acatggaccc ggaccgcccg ttcattctcg gcagccacac aacagatcgc      1500
     aacgaggcgc cgtgggacct gtacgcgaac cacgcgctct cgggctggcg cagccaggat      1560
     ctggacggct acggcaaggg atcgaacacg gtggtgaccg acgacacgcc cggccagctc      1620
     caggtgcagg tgaccagcga ccatgccaac tcgaggttcg tggcgggctg caacgtgcgc      1680
     atcgacggga acacagggcg ctcgcaggcg cgcggcgaag gcatcgagat tgcgaccgac      1740
     gcaaatgcgg tcatgcgcgc gaaccggggc atgctcatca cgaccgaggc tcgcgacggg      1800
     gcgacggctc ccatgaagga catgggcgag acgattgcgc gccttgacga ggcccgcacc      1860
     ctgcacgaca ggctggcggg ggaggcgcag gcaaacggcg cgcaggattc aggcggagat      1920
     cagaaggccg ttgcttcagc gatcagggcg cagaaccgtg cgctggcggg caaggccggg      1980
     gcgggcaaat ttcctgaatt cgcccagcct cacgtgacgc tggcaagtcc cgccggtatc      2040
     gagtccacca cggcgggcag cacccatgtt gcgagcggcg agcatcttgc gatgacgagt      2100
     ggagccgatg tggctattgc ggcgggcggg tcattcttcg ggacatttgg caacaagttg      2160
     cgcatgaccg tccagaaagc cggaatgcgg ctcgttgcag tgtcgggcga tatcgatctg      2220
     cgcgcgctga aagacagcat caatctcctg gccaggctca atgtcaccgt cacggccgag      2280
     aagatcacga tcagtgcgaa gcaggaagtc gaaatccggg gcggcggcag tttcacgcga      2340
     tggagtaacg ggaagatcta ccacggcacg ccggggcagt ttgaaatcca ttccgcaggg      2400
     cgcctgttta ctggaccgga ttcggcttcc cttccaactc ttcctgaatc ggcgcctggc      2460
     cagcaggagt tgcatttcgc gctaggcgcg ctcgcgaacg gcgctgctca ccggtacgtg      2520
     gaagaaccct atgaacttta ccagggcaac gcgctgatcg acagcggtgt gaccgacagc      2580
     tacgggcgcg tagtggtgaa agaccatcag ccggagacga cggagtattg cgtcaagctt      2640
     tgctatggcg gccagttcag gctgaaggtc aaggatgcac tcaatgccga tgccgaccat      2700
     atcgatcagc gcagcaaccg gggcgatcgt gcagtctga                             2739
//

If you have problems or comments...

PBIL Back to PBIL home page