(data stored in ACNUC7421 zone)

EMBL: CP000271.PE434

CP000271.PE434       Location/Qualifiers
FT   CDS_pept        505213..506610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2591"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33402"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R87"
FT                   /protein_id="ABE33402.1"
FT                   /translation="MKLERCLSHTYMKFARVRYLFSLWLLFAMTQAALAESPIHQLMTA
FT                   MSSSDSPRYTKLPLFAPHRKDFTCVYQEQHLPPVDPQAELWFQQALASELDPNIYWEDK
FT                   DWRKIYQLYQQAAERNHWKAMLNLAALILSGYPVPVRDPEMAIRWVEKAMQLEVPDAWD
FT                   TMGVYHMKGIVKGGDATSAYAFFQKAADMGSPSAQTFLGAALNAGWDNPGSGFWANISV
FT                   ATKMLECSLAQGYGDAADELEFIYAAPRTPEARLRAVTVLQEGAKLGSAKCASLLGSQF
FT                   RGMGLSDGKSLVGYVDKARAERYSKISDILEWYEGTLKLPNLDKVLPLPPAALPKWDGD
FT                   VQTLIDAAKAVTPPPTSPAHPSQSEPHAALTKAGLLRQLADRPEPLRCNGGLKCPQSGI
FT                   WEARVAAAHPLAALYNRWDRQAFVEKEASFPDPRQQHLDISAHDVRWTWLGSPNQLRVA
FT                   DVYDIAL"
     atgaaattag aaagatgcct aagccacact tacatgaagt tcgctcgcgt tcgatatctg        60
     ttcagtttgt ggcttctttt cgctatgaca caagccgccc ttgccgaatc cccaattcac       120
     cagttgatga cagccatgtc cagttccgat tcgcctcgtt atacgaaact gccactgttt       180
     gctccacatc ggaaggattt cacatgtgtg tatcaggaac agcatctgcc gcctgtcgat       240
     ccgcaggccg aactctggtt ccagcaagca ctcgcatcgg aacttgatcc caacatctat       300
     tgggaggaca aggactggag aaagatctac cagctttacc agcaggctgc ggaacgtaac       360
     cactggaaag cgatgctcaa cctcgcagca ttgatattga gcggctaccc ggttccggtg       420
     agggaccccg agatggcgat ccgctgggtg gagaaagcga tgcagcttga ggtgcccgat       480
     gcatgggaca cgatgggtgt ctatcacatg aagggcatcg tcaagggtgg agacgcaacg       540
     agcgcgtacg cgtttttcca gaaagcggcg gacatgggca gcccgtccgc ccagacgttt       600
     ctgggcgcag cgcttaacgc cggctgggac aatccgggta gcggcttctg ggctaacatt       660
     tctgtcgcga cgaagatgct tgaatgttcg ttagcacaag gctacggcga tgctgcagat       720
     gagttggagt tcatttatgc cgctcctcga acgccggaag ccaggcttcg tgcggtgaca       780
     gttttgcagg aaggggcaaa gctaggtagc gccaagtgcg caagtcttct tggtagtcag       840
     tttcgcggca tgggccttag cgacggcaag agtctcgtcg gttatgtcga taaagcgcgg       900
     gctgagcgct acagcaaaat cagcgacatc ctcgagtggt acgaaggcac cctgaagctc       960
     cccaatttgg acaaagtgtt gcctcttcct ccggccgcct taccgaaatg ggacggcgac      1020
     gtgcaaacac tgatcgacgc cgccaaggcc gttactccgc caccaacatc tccagcgcac      1080
     ccttcacagt ccgaacctca cgcggctctg acgaaagccg ggttgctgag acaactcgcg      1140
     gaccgacccg aaccattgcg ctgcaatggt gggctcaaat gtccgcagtc cggcatatgg      1200
     gaggctcgcg tggccgcagc gcatccgctt gccgcacttt ataaccgatg ggaccggcaa      1260
     gcgttcgtcg agaaagaggc cagctttccc gatccgcgac agcagcatct ggacatatcg      1320
     gctcacgacg tccgctggac ctggctgggc agccccaatc agttgcgcgt agcggatgtg      1380
     tatgacattg cattgtag                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page