(data stored in ACNUC7421 zone)

EMBL: CP000271.PE437

CP000271.PE437       Location/Qualifiers
FT   CDS_pept        508531..509589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2588"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33405"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R84"
FT                   /protein_id="ABE33405.1"
FT                   /translation="MKRAAPNVAMSVNLLDDLVATPWRHGFIALMRRINADPAIAPVGT
FT                   ALLPYSEPFRIGQKPSLVFAPSEVAEARIKDNRLHIRLHSLGMLGPNGPLPIHVTEIAR
FT                   EREALRGDTTLSNFLDVFHHRSLALLYRAWASAQAAASLDRPDHDRFSFYVGCVSGTSP
FT                   GRDRTVRLPSHARLASGAHLVHEARNPDALAMTVAHRFHVPARIDEWSLHWTVLPPKLQ
FT                   CRVGQERMSAILGGGAVLGEQVPGRMHRFCLVLGPLDIETYHRLTPRGADLLRLIALVR
FT                   AHMGLEYEWLLELQIRPQDATCASLGDNQQLGWSGWLGEPPAGEPVVGMRFEPELYVKQ
FT                   LVRNMQHTRRQA"
     gtgaaacgag cggcccccaa tgttgcaatg tcagtcaacc tgctcgatga cctggtggcc        60
     accccgtggc gacatggttt catcgcgctc atgcgccgca tcaatgcgga ccccgccatc       120
     gctccggtcg gcaccgcgct gctgccgtac tcggaaccgt tccgcatcgg ccagaagccg       180
     agtctcgtct tcgcgccgag tgaagttgcc gaagccagga tcaaggacaa caggttgcat       240
     atccggcttc atagcctggg gatgctgggt ccgaacgggc cattgccaat tcacgttaca       300
     gagatcgccc gcgagcgcga agcgctgcga ggtgacacga cgctgagcaa tttcctcgac       360
     gtctttcatc accgctcgct cgcgctcctg taccgcgcgt gggcctcggc gcaggcggcc       420
     gccagcctcg accggccgga tcacgaccgc ttctcgttct acgtcggctg tgtttccggc       480
     acgtcgccgg gacgcgaccg tactgtgagg ttgccctcgc atgcacgcct cgcgtcggga       540
     gcgcatctgg tgcacgaggc ccgcaacccg gacgcgctcg ccatgacggt cgcgcaccgc       600
     ttccacgtgc ccgcgcgcat cgacgaatgg tcgctgcact ggaccgtgct gccgccgaag       660
     cttcaatgca gggtggggca ggagcgcatg tccgccatcc tgggaggcgg cgcggtgctg       720
     ggcgaacagg tgcccggcag gatgcaccgg ttctgcctcg tgctcgggcc gctcgacatc       780
     gagacatacc accgactgac gccacgcggt gcggacctgc tgcggctgat cgcgctggta       840
     cgggcgcaca tgggcctgga gtacgagtgg ctgctggaat tgcagatcag gccgcaggat       900
     gcgacctgcg ccagcctcgg cgacaaccag cagctcggct ggtcgggctg gctcggggag       960
     ccgcccgcgg gcgagcccgt cgtgggcatg cgcttcgaac ccgaactgta cgtgaagcag      1020
     cttgtacgga acatgcagca caccagacgc caggcatag                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page