(data stored in ACNUC7421 zone)

EMBL: CP000271.PE438

CP000271.PE438       Location/Qualifiers
FT   CDS_pept        complement(509754..511670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2587"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2587"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33406"
FT                   /db_xref="GOA:Q13R83"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R83"
FT                   /protein_id="ABE33406.1"
FT                   /translation="MIAAAFSRVADRLLAADPGLVRLHTALRVALACLLTGVASIAWTA
FT                   SRHHPITLAAPGILFAMVAPLFVRDARRPAWFGTLVCLYLCACACFAAASVLSRFPLAG
FT                   DAGFLVVMFVGMLCQACGPRALGCAMLGVVCFYLGLYLHPSTTHLVQSLLLSAFGPLMV
FT                   ALVGRVIVPTRAATSLRLAVHTVTLRASRVLHAPVAAHLSALNEAALSLEEQLALLNPS
FT                   DAETIRERIAEVEVAAGQYAFASGHADGGVEANARVLRHAIARLRETAHQGNDARRAAF
FT                   APAGGAVALTASQRFADLRSKLCWLPATRATTAALLAMLIGHSLSPERWFWAVITTFVV
FT                   FLGTRSRADTVYRGAQRLVGTLGGALVSVSLVAPLQDSPVLLVAAMLLCVFGWAYFILN
FT                   AYAPGVFFITVLVGLVYGELGFAMGPLVELRIEEVLVGCVVSFAVAILMMPLAATRHVE
FT                   TRLASVLGALREVVRLTGSGALAADALPAMRKLDRSWHDLRIALRPLQTQRVVVWNPDV
FT                   ELATGSLLCCLHWARVLSDSARRGGLREKTALNAAEVGAAHVESIVARLDSLIARYNGV
FT                   ARAAGGDSDERASVTIDADIDVHKAPALAQLDGAVAQLFDRLMRPVSDARRVFNWTLRG
FT                   RSV"
     atgattgctg ccgcgttttc gcgcgtcgcc gaccgcctgc ttgccgcgga cccggggctc        60
     gtacgtcttc ataccgcgct gcgcgttgcg ctcgcctgcc tgctcaccgg cgtggccagc       120
     atcgcgtgga ccgcctcccg gcatcacccc atcacgctcg ccgcacccgg catcctcttt       180
     gcgatggtcg cgccgctgtt cgtgcgcgac gcgcggcggc ctgcgtggtt cggtacgctc       240
     gtctgcctct atctgtgtgc gtgcgcgtgc ttcgctgcgg cgagcgtgct gagccggttt       300
     ccgctggccg gcgatgccgg cttcctcgtc gtgatgttcg tgggcatgct gtgtcaggct       360
     tgcggtccgc gtgcattggg ttgtgcgatg ctcggcgtgg tgtgttttta cctcggcctg       420
     tatctgcatc cttcgacgac gcatctcgta cagtcgctcc tgctgtccgc gttcggcccg       480
     ttgatggtcg cgctggtggg ccgcgtgatc gtgccgacgc gggccgcaac gagcttgcgc       540
     ctcgcggtcc acacggtgac gctacgcgcg tcgcgtgtgc ttcacgctcc ggtggcggcg       600
     catctctccg cgctgaacga agccgcgctc tcgctcgaag aacaattggc gctgctcaat       660
     ccgtccgatg ccgaaacgat tcgtgaacgg attgcagaag tggaagtggc ggccgggcag       720
     tatgcgtttg cgtcgggcca cgcggacggc ggcgtcgagg cgaacgctcg cgtattgcgt       780
     catgcgattg cgcggctcag ggagacggcg catcaaggta acgacgcgcg gcgcgctgcg       840
     tttgctccag ccggcggcgc ggtcgcgctg actgcgtcgc agcgctttgc cgacttgcgc       900
     agcaagcttt gctggctccc cgccacgcgc gccacgaccg ctgcattgct cgccatgctg       960
     attggtcact cgctttcgcc ggaacgctgg ttctgggcgg tcattaccac attcgtcgtg      1020
     ttcctcggca cgcggtcgcg cgccgatacg gtgtatcgcg gcgcgcagcg cctcgtgggg      1080
     acgctgggtg gcgcgctcgt cagcgtgtcg ctggttgcgc cgctgcagga ctcgccggtt      1140
     ttgctggtcg ccgcgatgct gctgtgcgtg ttcggctggg cttacttcat cctgaacgcg      1200
     tacgcgccgg gagtgttttt tattaccgta ctcgtcgggt tggtctacgg cgagttgggg      1260
     ttcgcgatgg gaccgctggt cgaattgcga attgaagaag tgctggtggg ttgcgtcgtg      1320
     tcgttcgctg tcgcgatcct gatgatgccg cttgccgcga cgcggcatgt cgagacgcgg      1380
     ctggcctcgg tattgggcgc gctgcgtgaa gtggtgcggc tcaccgggtc gggagcgctg      1440
     gcggctgatg cgcttccggc gatgcgcaag ctcgatcgca gttggcacga tctgcgcatc      1500
     gcgctgcggc cgctgcaaac gcagcgcgtg gtggtgtgga atcccgatgt cgagctggcg      1560
     accggttcgc tgctgtgttg tctgcattgg gcgcgggtgt tgagtgattc cgcgcggcgc      1620
     ggcgggttgc gcgaaaagac ggcgctcaat gcggccgagg tcggcgcggc gcatgtcgag      1680
     tcgatcgtgg cgcgactcga ttcgttgatt gcgcgctata acggcgtggc gcgtgctgcg      1740
     ggtggtgatt ccgatgagcg tgcttctgtg acgatcgacg ctgatatcga tgttcataag      1800
     gcgccggcac tcgctcaact ggacggcgcg gtcgcacagt tgttcgaccg gttgatgcgg      1860
     ccggtttcgg atgcgcggcg ggtgttcaat tggacgttga gagggcggag tgtgtag         1917
//

If you have problems or comments...

PBIL Back to PBIL home page