(data stored in ACNUC7421 zone)

EMBL: CP000271.PE439

CP000271.PE439       Location/Qualifiers
FT   CDS_pept        complement(511986..512798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2586"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2586"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33407"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R82"
FT                   /protein_id="ABE33407.1"
FT                   /translation="MDTIAKGRQSHSLELEFGAGATPKPDSKGSAAQADGSLAQRVGAI
FT                   DWFDVEQGLNAYGSAMLHNLLSAGECDALTALYRRESLFRSRVVMARHGFGRGEYKYFA
FT                   YPLPPLIAELRSTLYPCLAPVANRWNEVMDIGVRYPATHAEFIERCHAAGQTRPTPLML
FT                   QYAIDDYNCLHQDLYGEHVFPLQVAILLSEPGADFTGGEFVMTEQRPRMQSRTEVVPLG
FT                   KGDAVVFAVHHRPVQGTRGPYRVNLRHGVSRLRSGQRHTLGVIFHDAT"
     atggatacga ttgcgaaggg tcgacaatcg cactcgctgg aattggagtt cggagccggt        60
     gcgaccccga agccggatag caaaggcagt gccgcgcagg ccgacggttc gctcgcgcag       120
     cgtgtcgggg cgatcgactg gttcgatgtc gagcaaggat tgaacgcgta tggcagcgca       180
     atgctgcaca acctgctcag cgccggagaa tgcgacgcgc tgaccgcgct ctatcggcgc       240
     gagtcattgt tccgcagccg cgtcgtgatg gcgcggcacg gttttggccg cggcgagtac       300
     aagtattttg cctatccgct gccaccattg attgcggagt tgcgtagcac gctttatccg       360
     tgcctcgcgc ccgtggcgaa tcgctggaac gaggtgatgg atatcggcgt tcgctatccg       420
     gctacgcatg cggaatttat cgagcgctgc cacgccgccg gccagacgcg ccccacgccg       480
     ctcatgcttc aatacgcgat cgacgactac aactgtctgc atcaggacct ctacggcgaa       540
     cacgtctttc cgctccaggt cgcgattctg ctgtccgagc ccggcgcgga cttcaccggc       600
     ggcgaattcg tcatgacgga gcagcgtcca cgaatgcaat cgcgcacgga agtggtgccg       660
     ctcggcaagg gcgacgcggt ggtattcgcc gtccatcacc gtccggtaca agggacgcgc       720
     ggcccgtacc gggtcaattt gcggcatggc gtgagccgcc tgcgctcggg ccagcggcat       780
     acgctcgggg tgatcttcca cgacgcgacc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page