(data stored in ACNUC7421 zone)

EMBL: CP000271.PE442

CP000271.PE442       Location/Qualifiers
FT   CDS_pept        515153..516331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2583"
FT                   /product="Putative CAIB/BAIF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33410"
FT                   /db_xref="GOA:Q13R79"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R79"
FT                   /protein_id="ABE33410.1"
FT                   /translation="MRPLDGIKVVTLEHAIAAPFCTRQLADLGARVIKIERPGVGDFAR
FT                   GYDERVHGLSSHFVWTNRSKESLSLDLKQPAAAEILDALVVDADVLVQNLAPGAADRLG
FT                   LGYDALSKKYPKLIVCDISGYGADGPYRDKKAYDLLIQSESGFLSITGSPGQPAKAGCS
FT                   IADIAAGMYAYSNILSALLLRGRTGHGCRIDVSMLESMVEWMGYPLYYAIDGQAPPALS
FT                   GAAHATIYPYGPFPAGDGKTVMLGLQNEREWKLFCERVLEQPELATDERFASNSKRTLA
FT                   REALREVIVAAFAKLSAAQVIERLDDAGIANAQMNTLADVWAHPQLKARERWHEVGTAA
FT                   GVVQALLPPGMPADFEPRMDPVPALGEHTDAILRELGYDSARIDALRAAGAI"
     atgagaccac tcgacggtat caaggtcgtc acgctcgaac acgcgatcgc cgcgccgttc        60
     tgcacgcgtc aactcgcgga tctcggcgcg cgggtaatca agatcgaacg ccctggcgtc       120
     ggcgacttcg cgcgcggcta cgacgagcgc gtgcatggac tgtcgtcgca tttcgtctgg       180
     accaaccgtt cgaaggaaag cctctcgctc gatctgaagc agcctgccgc ggcggagatt       240
     ctcgacgccc tggtcgtcga cgcggacgtg ctggtgcaga acctcgcccc cggcgccgcg       300
     gatcggcttg gtctcggtta cgacgccttg agcaagaagt atccgaagct gatcgtttgc       360
     gatatttccg gctatggtgc cgacggcccg taccgcgaca agaaagccta cgacctgctg       420
     attcagagcg aatccggttt tctgtcgatc accggttcgc cgggacagcc ggccaaggcc       480
     ggatgttcga ttgcggatat tgcggccggc atgtacgcgt attccaacat tctgagcgcg       540
     ctgctgttgc gcgggcgcac ggggcatggt tgccgcatcg acgtgtcgat gctggaaagc       600
     atggtggagt ggatgggtta tccgctctat tacgcgatcg acggccaggc gccgcccgcg       660
     ctctccggcg cggcgcacgc cacgatctat ccgtacggac cgttccccgc cggcgacggc       720
     aagacggtga tgctcggttt gcaaaacgaa cgcgaatgga agctcttttg cgagcgcgtg       780
     ctggagcagc cggaactcgc cacggacgag cgcttcgcgt cgaattcgaa acgcacgttg       840
     gcgcgtgaag cattgcgcga ggtgatcgtc gcggctttcg cgaagctgag cgcggcgcag       900
     gtgatcgaac ggctcgatga cgccggcatt gccaacgcgc agatgaatac gctcgccgac       960
     gtgtgggcgc atccgcaatt gaaggcgcgc gagcgctggc atgaagtggg tacggcagcg      1020
     ggcgtggtgc aggcattgct gccgccaggc atgccggcgg atttcgagcc gcgcatggat      1080
     cccgtccccg cgctcggcga gcacaccgac gcgatcctgc gcgagctcgg ctacgacagc      1140
     gcgcgtatcg acgcgctgcg tgctgccggc gcgatctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page