(data stored in ACNUC7421 zone)

EMBL: CP000271.PE443

CP000271.PE443       Location/Qualifiers
FT   CDS_pept        516400..517884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2582"
FT                   /product="Putative MmgE/Prp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33411"
FT                   /db_xref="GOA:Q13R78"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R78"
FT                   /protein_id="ABE33411.1"
FT                   /translation="MNDHPSLTLATFAAQLDFNSIPPAVVERTVNLYVDWLGSALAGKG
FT                   ARPVETIARFAREASGASKDGACEVLIDRSRATPYFAAMINGAASHFAEQDDVHNGSVF
FT                   HPATVVFPVALALAQARRASGRDLIAAAVAGYEVGIRVGEFLGRSHYKVFHTTGTAGTV
FT                   AAAATAGRLLGLSPTQMLDAFGSAGTQASGLWEFLRDAADSKQLHTAMAAANGLMAAQL
FT                   AADGFKGATHILEGAQGMAAGMSSDADPARLVDRLGSRWATAETSFKYHAACRHTHPAA
FT                   DALLAVVQEHRLAPRDMAKVVAHVHQGALDVLGAVVTPRTVHQAKFNMGTVLGLVAYHG
FT                   YAGVTEFEQGFDADEIAAFRANVEMAFDAEVDAAYPARWIGKVTVTTTDGRTLAGRVDE
FT                   PKGDPGNTLSRDEIATKLHRLAAFSGAATEGEAARLLGNAWRIVGQAQVGSVFESQSNA
FT                   ESNAGSNAGANAGANAGANAGANAGANAGANAAAAA"
     atgaacgatc atcccagtct gacgcttgcc accttcgccg ctcaactcga cttcaatagc        60
     attccgcctg cggtggtcga gcgcaccgtc aacctgtatg tcgactggct cggctcggcg       120
     ttggccggca aaggcgcgcg gccggtcgaa accattgcgc ggttcgcccg cgaggctagc       180
     ggcgcgtcga aggacggcgc ctgcgaagtg ttgatcgacc gcagccgcgc cacgccatat       240
     ttcgcggcca tgatcaacgg cgcggcgtcg cacttcgccg aacaggacga cgtgcacaac       300
     ggctcggtat ttcatcccgc gacggtcgtg tttccggtgg cactcgcgct ggcgcaagcc       360
     cgccgcgcat cgggccgcga cctgatcgcg gcggcggtgg cgggctatga agtcggcatc       420
     cgcgtcggcg agtttctggg gcgctcgcac tacaaggtgt ttcacaccac gggcacggcg       480
     ggcacggtgg cggcggctgc cacggcggga cggctgctcg gtctgtcgcc cacgcagatg       540
     ctcgacgcgt tcggctcggc gggcacgcag gcaagcggct tgtgggagtt tctgcgcgac       600
     gccgccgact cgaagcaact gcacacggca atggccgccg ccaacgggtt gatggccgcg       660
     caactcgccg ccgacggctt caagggcgcg acgcatattc tcgaaggcgc gcagggcatg       720
     gccgcgggca tgtcgagcga cgccgatccg gcgcgtctgg tcgaccgact gggcagccgg       780
     tgggcgacgg cggagacgtc gttcaagtat cacgcggcgt gccgtcatac gcaccccgcc       840
     gccgacgcgt tgctcgccgt ggtgcaggag caccgtctcg caccgcgcga tatggcgaaa       900
     gtcgtggcgc acgtgcatca aggcgcgctc gacgtgctcg gcgcggtcgt cacgccgcgc       960
     accgtgcacc aggcgaagtt caacatgggc acggtgctgg gactggtcgc gtatcacggc      1020
     tatgcgggcg tgacggaatt cgagcagggt ttcgacgcgg acgagattgc ggctttccgc      1080
     gccaacgtcg agatggcgtt cgacgccgag gtggatgccg cttatcccgc gcgctggatc      1140
     ggcaaggtga cggtcaccac caccgacggc cgcacgttag cgggccgcgt cgacgaaccg      1200
     aagggcgacc ctggcaatac gctgtcacgc gatgagatcg ccaccaagct gcatcggctg      1260
     gcggcgtttt cgggcgcagc cacggagggc gaggccgcgc gattgctcgg caacgcgtgg      1320
     cggatcgtgg ggcaagcgca ggtcgggtcg gtgtttgaat cacagtccaa cgccgagtcc      1380
     aacgccgggt ccaacgccgg ggccaacgcc ggggccaacg ccggggccaa cgccggggcc      1440
     aacgccgggg ccaacgccgg ggccaacgcg gcggcggccg catga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page